PAGE FOCUS: SHARING MY FAVORITES IN GREEN, NATURAL, VEGAN, ORGANIC, ANIMAL-FRIENDLY, EARTH-FRIENDLY AND CRUELTY-FREE PRODUCTS PAGE OVERVIEWSubscribe For Updates - Shop Kind Product Guide - FOOD & DRINK - HOUSEHOLD - PERSONAL CARE - GREEN LIVING Knowledge is power. Be the change. TWITTER / PINTEREST *Please ignore the copyright, awareness is the goal here - please share by all means!Tumblr (3.0; @buykind)http://buykind.tumblr.com/AwarenessHelps-shophttp://feedburner.google.com<img src="http://24.media.tumblr.com/tumblr_m3w4wqAkLu1r5lce1o1_500.jpg"/><br/><br/><p><strong><a href="http://animals4entertainment.tumblr.com" target="_self">Animals For Entertainment</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-entertainment&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong><a href="http://animals4fashion.tumblr.com" target="_self">Animals For Fashion</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-fashion&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong><a href="http://animals4food.tumblr.com" target="_self">Animals For Food</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-food&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong><a href="http://animals4research.tumblr.com" target="_self">Animals For Research</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-research&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong><a href="http://4greenearth.tumblr.com" target="_self">Earth and Environment</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-earth&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong><a href="http://equinerescue.tumblr.com" target="_self">Equine Protection & Rescue</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-equine&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong><a href="http://bhealthconscious.tumblr.com" target="_self">Health Wise Corner</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-health&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong><a href="http://petsawareness.tumblr.com" target="_self">Pets Awareness</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-pets&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong>Shop Kind Product Guide | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-shop&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong><a href="http://veglifestyle.tumblr.com" target="_self">Veggie and Vegan Support</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-veg&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong><a href="http://wildlyfeconservation.tumblr.com" target="_self">Wildlife Conservation</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-wildlife&loc=en_US" target="_blank">Email Updates</a></strong></p> <p><strong><a href="http://sac875.tumblr.com" target="_self">Home</a> | <a href="http://feedburner.google.com/fb/a/mailverify?uri=AwarenessHelps-main&loc=en_US" target="_blank">Email Updates</a></strong></p>http://buykind.tumblr.com/post/22882425648http://buykind.tumblr.com/post/22882425648Sun, 03 Jun 2012 12:00:00 -0400<img src="http://25.media.tumblr.com/tumblr_m51tr39hb61r5lce1o1_500.jpg"/><br/><br/><p><strong>THE VEGG IS THE WORLD’S FIRST VEGAN EGG YOLK!</strong></p> <p><strong>THE VEGG</strong> is a versatile egg yolk replacer that can be used (instead of eggs) in a wide range of recipes, and you can even use it straight as a liquid “yolk” for dipping toast. In fact, it looks, smells, and even tastes like eggs – but without all the cruelty. </p> <p>Now you can easily whip up “egg” noodles, French toast, custard, pan frittata, Hollandaise sauce, and so much more without contributing to or feeling guilt about using eggs! It’s also ideal as a liquid base when breading foods for frying. </p> <p><strong>THE VEGG </strong>was created to help put an end to the suffering of male and female chicks in industrialized egg production factory farms through competing with the industry by way of offering the public a cruelty-free, ecologically sustainable zero cholesterol, gluten-free alternative to eggs.</p> <p><strong><a href="http://thevegg.com/" target="_blank">SOURCE</a> | <a href="http://litasworld.com/2012/04/the-vegg-vegan-egg/" target="_blank">REVIEW</a></strong></p>http://buykind.tumblr.com/post/24335537632http://buykind.tumblr.com/post/24335537632Sun, 03 Jun 2012 11:59:00 -0400alternativedieteggeggshealthlifestylemiraclenutritionveganvegetarianwellnessyolkcruelty free<img src="http://24.media.tumblr.com/tumblr_m4rhpjvzfU1r5lce1o1_250.jpg"/><br/><br/><p><strong>SAMBAZON </strong>is the pioneer of organic amazon superfoods, providing functional health juices, smoothies, and frozen products made from delicious blends of handpicked Brazilian fruits and botanicals.</p> <p>Freshies / Frozen / Energy / Supplements</p> <p><strong><a href="http://sambazon.com/" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/23971469962http://buykind.tumblr.com/post/23971469962Mon, 28 May 2012 22:03:00 -0400acaifoodhealthnaturalnutritionorganicveganwellnesssuperfood<img src="http://25.media.tumblr.com/tumblr_m4ein4gCgu1r5lce1o1_500.jpg"/><br/><br/><p><strong>ALO DRINK </strong>offers deliciously refreshing drinks that support healthy lifestyles. Our drinks are infused with real, all natural aloe vera juice and pulp—a fine source of vitamins and essential amino acids. </p> <p>ALŌ Exposed (original aloe vera with <strong>honey</strong>) - <strong><a href="http://www.vegetus.org/honey/honey.htm" target="_blank">What’s wrong with it?</a></strong></p> <p>ALŌ Awaken (wheatgrass & aloe vera)</p> <p>ALŌ Elated (olive leaf tea & aloe vera)</p> <p>ALŌ Enliven (12 fruits & vegetables with aloe vera)</p> <p>ALŌ Allure (mangosteen, mango & aloe vera)</p> <p>ALŌ Enrich (pomegranate, cranberry & aloe vera)</p> <p>ALŌ Appeal (pomelo, pink grapefruit, lemon & aloe vera)</p> <p><strong><a href="http://alodrink.com" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/23519100837http://buykind.tumblr.com/post/23519100837Sun, 20 May 2012 22:24:00 -0400healthhoneynutritionvitaminswellnessaloevera<img src="http://24.media.tumblr.com/tumblr_m3777uu9ml1r5lce1o1_500.jpg"/><br/><br/><p><strong>NATURE’S GATE </strong>is committed to using pure, sustainably harvested herbs, fruits and essential oils, without animal-derived ingredients, to enhance the overall health and wellbeing of our customers and our planet.</p> <p>Hair Care / Bath Care / Skin Care / Deodorants / Oral Care / Facial Care / Acne Care / Sun Care</p> <p><strong><a href="http://www.natures-gate.com" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/21984343711http://buykind.tumblr.com/post/21984343711Sat, 28 Apr 2012 12:31:00 -0400beautygreenhealthnaturalveganwellnesseco<img src="http://25.media.tumblr.com/tumblr_m2e6v6QSC61r5lce1o1_500.jpg"/><br/><br/><p><strong>FAKE MEATS </strong>strives to be an authority on ‘fake meat’ or ‘mock meat’ products for vegans and vegetarians. They add new products regularly and offer the largest selection of fake meats around.</p> <p>Chips & Snacks / Gifts & Combo Packs / Jerky / Meat Substitutes / Seasonings & Condiments / Gluten-Free Products / Vegan Products</p> <p><strong><a href="http://fakemeats.com" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/20994909825http://buykind.tumblr.com/post/20994909825Thu, 12 Apr 2012 20:33:00 -0400mockfakemeatsvegetarianveganmeat substitutegluten free<img src="http://24.media.tumblr.com/tumblr_m219214ZFD1r5lce1o1_500.gif"/><br/><br/><p><strong>VEGECYBER </strong>offers a wide variety of frozen vegan seafood and vegan meat substitutes including: salmon, tuna, shrimps, ham, steak, lamb, chicken breast and nuggets, hot dogs, turkey, pork chops, BBQ ribs, crabs, bacon, sausages, beef chunks, ground beef, little drum sticks and more. They even have eggless fried eggs!</p> <p><strong><a href="http://vegecyber.com" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/20558745325http://buykind.tumblr.com/post/20558745325Thu, 05 Apr 2012 20:51:00 -0400healthnaturalorganicveganvegetarianwellnessfakemeatmockcrueltyfree<img src="http://24.media.tumblr.com/tumblr_m1rus82x951r5lce1o1_500.png"/><br/><br/><p><strong>GLYDE PREMIUM VEGAN CONDOMS </strong>made using our exclusive patented technology that makes GLYDE ultra thin and sleek to maximize sensation for both partners, without ever compromising strength and reliability. You’ll absolutely feel the difference.  </p> <p>GLYDE Ultra / GLYDE Maxi / GLYDE Slim-Fit </p> <p>Vanilla / Licorice / Blueberry / Wildberry / Strawberry</p> <p>No Animal Testing</p> <p>No Animal By-Products</p> <p>Delicious Organic Real Fruit Extracts </p> <p><strong><a href="http://glydeamerica.com" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/20251975386http://buykind.tumblr.com/post/20251975386Sat, 31 Mar 2012 19:04:00 -0400ethicshealthsexveganwellnesscruelty freefair trade<img src="http://25.media.tumblr.com/tumblr_m1f9fwqCV01r5lce1o1_400.gif"/><br/><br/><p><strong>VEGAN ESSENTIALS </strong>is your one-stop online vegan superstore, with over 1700 different cruelty-free items in stock. Great prices, the largest selection, fast service, and worldwide shipping - everything a vegan needs!</p> <p>Babies & Children / Hair Care / Candles / Books / Companion Animal Supplies / Cosmetics / Facial & Skin Care / Bath & Body / Food & Sweets / Footwear / Fragrances & Oil / Outdoor Wear / Home / Personal Care / Accessories / Shirts & Message Items / Vitamins & Therapeutics</p> <p><strong><a href="http://veganessentials.com/" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/19875023428http://buykind.tumblr.com/post/19875023428Sat, 24 Mar 2012 23:52:00 -0400alternativescrueltyethicsfreeveganvegetarian<img src="http://24.media.tumblr.com/tumblr_m17mgfza9j1r5lce1o1_500.jpg"/><br/><br/><p><strong>BETWEEN! NATURAL DENTAL GUM </strong>is what I reach for when I want a piece of gum or in this case, 2 pieces! It is great anytime but especially after meals when you can’t brush, it actually helps take care of your teeth! This is probably the only gum out there that gives you minerals and antioxidants!</p> <p>Natural sweeteners are used — not artificial crap like aspartame, splenda aka sucralose or saccharin. I have tried many types of natural gum and based on taste and texture, this is definitely at the top of my list and the best natural gum out there!</p> <p>Natural Cool Mint / Natural Wintergreen / Natural Cinnamon</p> <p><strong><a href="http://www.eco-dent.com/between.php" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/19655108480http://buykind.tumblr.com/post/19655108480Tue, 20 Mar 2012 20:53:00 -0400antioxidantsdentalhealthmineralsnaturalchewinggumwellnessgreen<img src="http://25.media.tumblr.com/tumblr_m4ejo1pHnZ1r5lce1o1_500.jpg"/><br/><br/><p><strong>HALF NAKED POPCORN</strong></p> <p>We use only baby tender white corn, the plumpest and most tender popping corn ever raised on the farm. Then we lovingly air-pop these premium kernels into scrumptious fluffy morsels of gourmet goodness. And for the all-important final touch, performed in complete privacy, we lightly dress them in non-hydrogenated oil. And, like all good popcorn, you will naturally find kernels at the bottom of the bag.<strong><br/></strong></p> <p><strong><a href="http://www.goodhealthnaturalproducts.com/good-health-natural-foods/products/popcorn/popcorn-naked-popcorn/" target="_blank">SOURCE</a>* | <a href="http://www.kidkritics.com/good-health-natural-foods/half-naked-popcorn/" target="_blank">REVIEW</a></strong></p> <p><em>*Safari Users: The link above does not display correctly, using Internet Explorer is suggested.</em></p>http://buykind.tumblr.com/post/23520737846http://buykind.tumblr.com/post/23520737846Mon, 12 Mar 2012 23:34:00 -0400popcornhealthwellnessnaturalnutritionsnacks<img src="http://24.media.tumblr.com/tumblr_lzykwrLSiL1r5lce1o1_400.jpg"/><br/><br/><p><strong>ANIMALS INK </strong>offers a wide variety of high-quality and useful pet magnets for the animal lover as well as animal themed gifts, fundraisers, promotional products and marketing materials.</p> <p>Car Magnets / Pens / Keychains / Magnet Clips / Air Fresheners / Can Koolerz / Pet Accessories / Business Cards / Brochures</p> <p><strong><a href="http://animalsink.com" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/18256012480http://buykind.tumblr.com/post/18256012480Sat, 25 Feb 2012 12:07:00 -0500animalsmagnetspetsmessagecutegiftsproductshighquality<img src="http://24.media.tumblr.com/tumblr_lzka5mr8hj1r5lce1o1_400.jpg"/><br/><br/><p><strong>ANNIE’S HOMEGROWN </strong>provides simple, natural, down-to-earth foods that taste great and are easy to love. Eat Responsibly. Act Responsibly.</p> <p>Pasta / Snacks / Cereal / Dressings & Oils / BBQ & Condiments / Pizza / Special Diets - Vegan / Gluten Free</p> <p><strong><a href="http://www.annies.com/" target="_blank">SOURCE</a></strong></p> <p><strong>WHERE I FOUND IT: MOST NATURAL MARKETS AND WALMART</strong></p>http://buykind.tumblr.com/post/17790483669http://buykind.tumblr.com/post/17790483669Fri, 17 Feb 2012 18:48:00 -0500gluten freehealthnaturalorganicveganwellnessusda<img src="http://25.media.tumblr.com/tumblr_lxnyc4ldjJ1r5lce1o1_500.gif"/><br/><br/><p><strong>ECOVER </strong>is devoted to developing and producing effective and ecological washing and cleaning products made from plant-based and mineral ingredients. Their focus is to provide effective, sustainable washing and cleaning solutions that can be used daily by people all around the world.</p> <p>Rinse Aid / Grapefruit & Green Tea DW Liquid / Automatic DW Powder / Herbal DW Liquid / Lemon & Aloe Vera DW Liquid / Auto DW Tablets ZERO / Auto DW Powder ZERO / Auto DW Tablets / Fabric Softener Sunny Day / Laundry Powder ZERO / Laundry Wash / Delicate Wash / Fabric Softener Morning Fresh / Laundry Liquid Concentrate Sunny Day / Laundry Liquid Concentrate ZERO / Non-Chlorine Bleach Powder / Stain Remover / Laundry Powder / Non-Chlorine Bleach Liquid - this is just a partial list, visit their website for more products!</p> <p><strong><a href="http://ecover.com/us/en/" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/15701704780http://buykind.tumblr.com/post/15701704780Wed, 11 Jan 2012 21:16:00 -0500ecogreennaturalhomehouseholdhealthwellness<img src="http://25.media.tumblr.com/tumblr_lxidv91JT71r5lce1o1_500.jpg"/><br/><br/><p><strong>ONYA BAGS </strong>are a wise alternative to plastic bags and are great to use every day - even to carry your lunch like I do! They are made of strong, light-weight parachute material. Throw some in your purse or your car so you always have one.</p> <p>Original Onya / BIG Onya / Onya Back / Onya Lunch / Onya Side / Onya Weigh / Dump It Onya</p> <p><strong><a href="http://onyabagsusa.com/" target="_blank">SOURCE</a> </strong></p>http://buykind.tumblr.com/post/15544222927http://buykind.tumblr.com/post/15544222927Sun, 08 Jan 2012 21:06:00 -0500earthenvironmentgreennaturalreusableecoalternative<img src="http://24.media.tumblr.com/tumblr_lxideiZvZ31r5lce1o1_500.jpg"/><br/><br/><p>The<strong> SKOY </strong>Cloth is a fabulous, absorbent, biodegradable and natural multi-use cloth. It is earth friendly and perfect for use in your kitchen, bathroom, and on most surface areas in your home or office. It can be used in place of your sponge, wash cloth or paper towels. </p> <p><strong><a href="http://www.skoycloth.com/" target="_blank">SOURCE</a> </strong></p>http://buykind.tumblr.com/post/15543664763http://buykind.tumblr.com/post/15543664763Sun, 08 Jan 2012 20:56:00 -0500clothearthenvironmentgreennaturalreusablereuseeco<img src="http://25.media.tumblr.com/tumblr_lwl7k95Vo31r5lce1o1_250.jpg"/><br/><br/><p><strong>PANGEA </strong>offers a huge selection of high-quality, completely cruelty-free vegan products. They look for the best in cruelty-free essentials and hard-to-find alternatives to animal-based products.</p> <p>Vegan Food Items / Body Care / Vegan Vitamins / Cruelty-Free Cosmetics / Vegan Shoes / Vegan Belts / Shirts / Stickers / Non-Leather Wallets & Bags / Winter Gear & Dresswear / Books / Videos / Home / Office / Cleaning / Dog and Cat Products / Miscellaneous / Vegan Gift Baskets / Gifts / Candles</p> <p><strong><a href="http://veganstore.com" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/14600354760http://buykind.tumblr.com/post/14600354760Wed, 21 Dec 2011 23:09:00 -0500alternativesethicsveganvegetariancruelty free<img src="http://24.media.tumblr.com/tumblr_lwbsk86W3o1r5lce1o1_500.jpg"/><br/><br/><p><strong>ZENSOY</strong> offers a variety of nutritious soy milks and puddings, which are certified organic and are a natural source of soy protein, a powerful vegetarian food with a myriad of health benefits.</p> <p>Half Gallon Milks are available in 4 flavors: Plain, Vanilla, Chocolate and Cappuccino</p> <p>Puddings are available in 4 flavors: Vanilla, Chocolate, Chocolate & Vanilla Swirl, and Banana</p> <p>8.25 oz. Soy on the Go Milks are available in 3 flavors: Vanilla, Chocolate and Cappuccino</p> <p><strong><a href="http://zensoy.com/" target="_blank">SOURCE</a></strong></p>http://buykind.tumblr.com/post/14334491173http://buykind.tumblr.com/post/14334491173Fri, 16 Dec 2011 21:07:00 -0500healthmilknutritionsoymilkveganvegetarianwellness<img src="http://24.media.tumblr.com/tumblr_lvrcvm10FL1r5lce1o1_400.jpg"/><br/><br/><p><strong>JUST NATURALS & COMPANY </strong>offers the highest quality in natural and non-toxic cleaning and personal care products for those seeking to rid their homes of chemically derived products.</p> <p>Cleaning / Laundry / Aromatherapy / Soaps & Gels / Skin Care / Face Care / Salts & Scrubs / Baby / Pet Care</p> <p><strong><a href="http://www.justnaturalproducts.com/" target="_blank">SOURCE</a> </strong></p>http://buykind.tumblr.com/post/13804236613http://buykind.tumblr.com/post/13804236613Mon, 05 Dec 2011 20:16:00 -0500householdnaturalgreenhomehealthwellnessearthenvironment<img src="http://24.media.tumblr.com/tumblr_lvo1xb8xGf1r5lce1o1_500.jpg"/><br/><br/><p><strong>EOS </strong>provides stylish, fun and effective daily-use beauty products that are organic, natural, kind to the planet and not tested on animals.</p> <p>Ultra Moisturizing Shave Cream / Lip Balms / Natural Hand and Body Lotions</p> <p><strong><a href="http://evolutionofsmooth.com/" target="_blank">SOURCE</a> </strong></p>http://buykind.tumblr.com/post/13717406262http://buykind.tumblr.com/post/13717406262Sun, 04 Dec 2011 01:27:00 -0500beautynaturalcruelty freehealthwellness