stories of clean eating in a chunky world var _gaq = _gaq || []; _gaq.push(['_setAccount', 'UA-25987931-1']); _gaq.push(['_trackPageview']); (function() { var ga = document.createElement('script'); ga.type = 'text/javascript'; ga.async = true; ga.src = ('https:' == document.location.protocol ? 'https://ssl' : 'http://www') + '.google-analytics.com/ga.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(ga, s); })(); Tumblr (3.0; @thechunkytales)http://thechunkytales.tumblr.com/ChunkyTaleshttp://feedburner.google.comI am not going to lie, this is probably my favorite product to review so far. Having little...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=mg6eWP6Z0JY:GsG6ZB8fmJw:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=mg6eWP6Z0JY:GsG6ZB8fmJw:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/mg6eWP6Z0JY/36641372556http://thechunkytales.tumblr.com/post/36641372556Mon, 26 Nov 2012 22:26:00 -0500http://thechunkytales.tumblr.com/post/36641372556Its a Marvelous Monday indeed! Such a great past few days that make me truly enjoy the little...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=L8LrMNuS8aE:eaoUQ3cmBcs:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=L8LrMNuS8aE:eaoUQ3cmBcs:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/L8LrMNuS8aE/36067111893http://thechunkytales.tumblr.com/post/36067111893Mon, 19 Nov 2012 10:30:02 -0500mimmmarvelousinmymondayhttp://thechunkytales.tumblr.com/post/36067111893Again, on a search for the perfect on the go protein bar has proven on the difficult side. I love My...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=UkAtctiL44U:sSN4xPH-44g:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=UkAtctiL44U:sSN4xPH-44g:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/UkAtctiL44U/34756667637http://thechunkytales.tumblr.com/post/34756667637Thu, 01 Nov 2012 08:42:06 -0400questnutritionquestbarproteinbarcleaneatingreviewhttp://thechunkytales.tumblr.com/post/34756667637My heart truly goes out to everyone that has been affected by the hurricane. Most in DC were...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=WPdIQjzTey8:WJ5yCtZr8Ek:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=WPdIQjzTey8:WJ5yCtZr8Ek:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/WPdIQjzTey8/34697058956http://thechunkytales.tumblr.com/post/34697058956Wed, 31 Oct 2012 07:57:27 -0400WIAWcleaneatinggorawhttp://thechunkytales.tumblr.com/post/34697058956As hurricane Sandy started to reap havoc on the east coast, I was forced to think of what perishable...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=6loyim8ob-w:VyFZHCL_F9c:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=6loyim8ob-w:VyFZHCL_F9c:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/6loyim8ob-w/34633887415http://thechunkytales.tumblr.com/post/34633887415Tue, 30 Oct 2012 09:05:00 -0400p28proteinbreadcleaneatingproteinproductreviewhttp://thechunkytales.tumblr.com/post/34633887415Well its Monday and the thought of Sandy has taken over the east coast. Maybe I should be...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=kSUWqT31XaQ:yKsM9lOYH8E:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=kSUWqT31XaQ:yKsM9lOYH8E:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/kSUWqT31XaQ/34563812652http://thechunkytales.tumblr.com/post/34563812652Mon, 29 Oct 2012 09:59:00 -0400MIMMhttp://thechunkytales.tumblr.com/post/34563812652Earlier this fall, I received a nice package from the people over at The Simply Bar. I had seen...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=Ts5dMKilX_I:A8avgThL7W8:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=Ts5dMKilX_I:A8avgThL7W8:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/Ts5dMKilX_I/34496653391http://thechunkytales.tumblr.com/post/34496653391Sun, 28 Oct 2012 13:23:50 -0400thesimplybarsimplychipsreviewcleaneatinghttp://thechunkytales.tumblr.com/post/34496653391                       How to make my Monday more marvelous? Sometimes I just have the case of the...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=ZGlVaBDOhIg:IH-zLRiBCeQ:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=ZGlVaBDOhIg:IH-zLRiBCeQ:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/ZGlVaBDOhIg/33649218053http://thechunkytales.tumblr.com/post/33649218053Mon, 15 Oct 2012 13:45:00 -0400MIMMmarvelousinmymondaycleaneatingrecipeblackbeanburgerhttp://thechunkytales.tumblr.com/post/33649218053Its Wednesday - HUMP DAY - half way - woot woot! Here are my eats for What I ate Wednesday (from...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=LXcQpYup1Vk:L86yofmH0VQ:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=LXcQpYup1Vk:L86yofmH0VQ:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/LXcQpYup1Vk/33302222704http://thechunkytales.tumblr.com/post/33302222704Wed, 10 Oct 2012 12:06:00 -0400wiawwhatiatewednesdayp28questnutritioncleaneatinghttp://thechunkytales.tumblr.com/post/33302222704It&#8217;s that time again. A loving lately post - all about what I am loving lately. Greens Two...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=BycJ6PiwguU:KiSZAP-M8pM:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=BycJ6PiwguU:KiSZAP-M8pM:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/BycJ6PiwguU/33233537301http://thechunkytales.tumblr.com/post/33233537301Tue, 09 Oct 2012 11:30:49 -0400proteinpancakesplantpowergreenskalerecipecleaneatinghttp://thechunkytales.tumblr.com/post/33233537301I love love love Ms. Katie&#8217;s Healthy Diva Eats blog. It so cute, peppy, informative, and...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=mfOsgiE3oFM:tlpEY_zGo3w:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=mfOsgiE3oFM:tlpEY_zGo3w:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/mfOsgiE3oFM/32670455424http://thechunkytales.tumblr.com/post/32670455424Mon, 01 Oct 2012 11:29:41 -0400http://thechunkytales.tumblr.com/post/32670455424Crunch time. Those last few weeks before bikini season? Those few days before you birthday? That...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=FRbo6SJxgcI:rfpehClcwEQ:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=FRbo6SJxgcI:rfpehClcwEQ:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/FRbo6SJxgcI/31766197379http://thechunkytales.tumblr.com/post/31766197379Mon, 17 Sep 2012 21:00:13 -0400cleaneatingfoodfoodporneatcleanfitfluentialhttp://thechunkytales.tumblr.com/post/31766197379I apologize. I have been a bit MIA. Lots of stuff going on - but boy did I miss blogging. I have so...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=XXX_i6SB1vc:bbsXaeZWJCM:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=XXX_i6SB1vc:bbsXaeZWJCM:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/XXX_i6SB1vc/31702314469http://thechunkytales.tumblr.com/post/31702314469Sun, 16 Sep 2012 21:35:01 -0400dcyogastrogaunionmarketdcunionmarketwashingtondchttp://thechunkytales.tumblr.com/post/31702314469September. What defines September? Is it that pumpkin spiced latte at Starbucks that the blogging...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=eQyDWqCVZkE:nLwk7nneJd8:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=eQyDWqCVZkE:nLwk7nneJd8:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/eQyDWqCVZkE/30932130059http://thechunkytales.tumblr.com/post/30932130059Wed, 05 Sep 2012 09:37:56 -0400wiawwhatiatewednesdaycleaneatingp28http://thechunkytales.tumblr.com/post/30932130059Two of my favorite things. (long pause) Kidding. Okay, well partially. I will get to this in a...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=2ZTegQgEBes:Ui4lSu0mo2I:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=2ZTegQgEBes:Ui4lSu0mo2I:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/2ZTegQgEBes/30076795468http://thechunkytales.tumblr.com/post/30076795468Thu, 23 Aug 2012 22:28:00 -0400peanutbutterglutenfreefooddiarycleaneatingeatcleanrecipesfoodpornfitfluentialhttp://thechunkytales.tumblr.com/post/30076795468Wednesday is FINALLY here! Wednesday is my new rest day and boy do I look forward to it....<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=suBfyd_J0dQ:ApK_x_bDsao:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=suBfyd_J0dQ:ApK_x_bDsao:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/suBfyd_J0dQ/29965061598http://thechunkytales.tumblr.com/post/29965061598Wed, 22 Aug 2012 10:04:39 -0400wiawwhatiatewednesdayfooddiaryfoodpornthesimplybarsimplychipshttp://thechunkytales.tumblr.com/post/29965061598As you know by now, pancakes of every size and color define my weekends. I wouldn&#8217;t go a day...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=SCWA2NT6kKY:o3AaUyOIyac:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=SCWA2NT6kKY:o3AaUyOIyac:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/SCWA2NT6kKY/29835228044http://thechunkytales.tumblr.com/post/29835228044Mon, 20 Aug 2012 13:04:00 -0400pancakeseatcleancleaneatingmeridianhillparkdcbootcampbreakfastfoodpornhttp://thechunkytales.tumblr.com/post/29835228044<iframe src="//www.tumblr.com/video/thechunkytales/29551252337/400" id="tumblr_video_iframe_29551252337" class="tumblr_video_iframe" width="400" height="225" style="display:block;background-color:transparent;overflow:hidden;" allowTransparency="true" frameborder="0" scrolling="no" webkitAllowFullScreen mozallowfullscreen allowFullScreen></iframe><br/><br/><p>My relationship with peanut butter. To a T.</p><div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=Izmuu94l08w:U1o7CGm-wgY:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=Izmuu94l08w:U1o7CGm-wgY:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/Izmuu94l08w/29551252337http://thechunkytales.tumblr.com/post/29551252337Thu, 16 Aug 2012 10:14:42 -0400http://thechunkytales.tumblr.com/post/29551252337On the wonderful What I Ate Wednesday, I usually post what I ate the day before. Well, this time is...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=ed3AVoVn7HA:O4c7UmOfhZo:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=ed3AVoVn7HA:O4c7UmOfhZo:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/ed3AVoVn7HA/29550100119http://thechunkytales.tumblr.com/post/29550100119Thu, 16 Aug 2012 09:40:17 -0400WIAWwhatiatewednesdayfooddiarycleaneatingeatcleanthesimplybarsimplybarhttp://thechunkytales.tumblr.com/post/29550100119I get these monthly boxes from Conscious Box (posted about it first here) - sometimes they are...<div class="feedflare"> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=Z-HNYE-l4k0:jYVGYss7dE0:yIl2AUoC8zA"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=yIl2AUoC8zA" border="0"></img></a> <a href="http://feeds.feedburner.com/~ff/ChunkyTales?a=Z-HNYE-l4k0:jYVGYss7dE0:qj6IDK7rITs"><img src="http://feeds.feedburner.com/~ff/ChunkyTales?d=qj6IDK7rITs" border="0"></img></a> </div>http://feedproxy.google.com/~r/ChunkyTales/~3/Z-HNYE-l4k0/29356263198http://thechunkytales.tumblr.com/post/29356263198Mon, 13 Aug 2012 16:42:00 -0400consciousboxmailgorawhttp://thechunkytales.tumblr.com/post/29356263198