tag:blogger.com,1999:blog-27407738Wed, 02 Oct 2024 07:08:29 +0000MicroStrategyBangaloreMumbaiIndiaCognosMetadataBMCBusiness ObjectsCovansysCybageAccidentBikeGurvinderJobNaveenParamjeetArsenalAttributeCSCChinaDesktopEngineErrorFICFoodFreeInterviewKarthikLearnLicensePayPalPeterPraffulProjectReportSQLSaScanMDSchemaServerlove3rd partyAdAmitArvindAseemAshokAsifAuthenticationBESTBIBSEBad Hair DayBangadeshBlaizeBloggingBoltonBusiness IntelligenceC-NetCDACCEOCPUCarCease and DesistCertificationChrisChristmasClassesClusteringCostDamienDiwaliDonDouble countingDuplicateDurgaDylanEPFEPF ClaimESPNEducationExamFactFact tableFilterFirefoxFortFortune100ForumGautamGeetaGoogleGunasagarHSBCHaniIBMIPOInvitationJamesJetJohnKananKeysKimKolteKoramangalaLU tableLinkedInLoanIQLoblawLopezMD DoctorMSTR9ManUMandyaManiMastecMetricsMicrostrategy9MummyMusicNOCNarrowcast ServerNeerajNessNewsNoelODBC errorOrionPBTPMTPakistanPapaPartitionPerformancePiramydPizzaPlatoRTORajRajendraReport LimitRickRohitRongSAICSAPSASSCDSachitSamSanjaySharadShubhSifySimoneSnowflake SchemaSpice JetSriramStar SchemaStockSudhaSystimeTADATARPTableTeradataTiersTrafficTripUEFAUSAUnicornVLDBVeertaVehicleView FilterVodkaWeddingWidthYeshwantaxisdon'teBayfactlessgmx.nethttp://www.microstrategy101.comin-memoryivylay offlikem3objexp.ocxmetric aliasespappephishingpink sliprecessionskyspamsrikantasrinivassripatisunayantatatraininguncategorizedzingalalaLife and MicroStrategy "straight from heart" - the Nomad's MicroStrategy bloghttp://roznamcha.blogspot.com/noreply@blogger.com (Ashish Tiwari)Blogger155125tag:blogger.com,1999:blog-27407738.post-937664472217780704Sun, 24 May 2009 13:32:00 +00002009-05-24T14:34:48.224+01:00http://www.microstrategy101.comWe have moved the blog to own domain: http://www.microstrategy101.comChange your Feedburner and Google Friend Connect.Also the MicroStrategy Forum can be found here.Comments are blocked on this blog now.http://roznamcha.blogspot.com/2009/05/we-have-moved.htmlnoreply@blogger.com (Ashish Tiwari)0tag:blogger.com,1999:blog-27407738.post-3299517620679497665Fri, 22 May 2009 09:27:00 +00002009-05-22T10:28:01.730+01:00In a previous post I’ve warned about the not so automatically behavior of the automatic mapping. However, I can’t blame the manual mapping for the same degree of inconsistency. I mean, boy, that’s as manual as it gets!Take a manually mapped attribute and have a look at its source tables. Now drop the attribute from one of these tables (on database and Catalog level) and try to run a report which http://roznamcha.blogspot.com/2009/05/manual-mapping.htmlnoreply@blogger.com (Sorin)0tag:blogger.com,1999:blog-27407738.post-8736178493792038127Fri, 15 May 2009 16:54:00 +00002009-05-15T17:59:36.212+01:00Business IntelligenceMicrostrategy9MSTR9Dashboard Features: Easy to add Tabs and report layouts(Panels) Default templates available to choose the number of reports per tab Tab adding is just clicking plus sign(+) Drilling is possible in AJAX or DHTML mode All, Total features are introduced and bugs are fixed Many graph issues in 8 are fixed in 9Prompt &amp; Filter Prompt and Filter can be created in WEB New web options for http://roznamcha.blogspot.com/2009/05/microstrategy-9-ga-features.htmlnoreply@blogger.com (Unknown)0tag:blogger.com,1999:blog-27407738.post-6736748210402720515Tue, 12 May 2009 10:55:00 +00002009-05-12T12:13:50.668+01:00MetricsMicroStrategyWidthFor hinding Metric column only in Web: (assuming that English language was the Locale.)On the Web Server machine, go to the default location of <>\Web ASPx\WEB-INF\classes\resources and open up the file called MessagesBundle_en_US.properties. Go to the line 'mstrWeb.1158'. For English language, 'Metrics' is the value. Delete the word 'Metrics' and leave one single space. Save the close the file. http://roznamcha.blogspot.com/2009/05/how-to-hind-metric-column.htmlnoreply@blogger.com (Ashish Tiwari)0tag:blogger.com,1999:blog-27407738.post-2010852964908773893Tue, 12 May 2009 10:26:00 +00002009-05-12T12:18:39.675+01:00IndiaMicroStrategyFinally, MicroStrategy Inc is going to host BI classes in India.20th May: co-sponsored by Systech22nd May: co-sponsored by InfoStepLocation are not specified, but looks like they would be hosted at Chennai and Mumabi respectively.http://roznamcha.blogspot.com/2009/05/microstrategy-event-in-india.htmlnoreply@blogger.com (Ashish Tiwari)0tag:blogger.com,1999:blog-27407738.post-7887147120646713934Thu, 07 May 2009 04:15:00 +00002009-05-07T05:16:43.326+01:00It appears that someone at MicroStrategy was receptive enough to come up with the idea of including a search by ID function in version 9. It’s called… “Search by ID” (act surprised now) and it can be found under the Tools menu of the “Search for Objects” window.This, and the new “Translate” function in MicroStrategy 9 render my “Search by ID v2” application almost obsolete. I refrain from callinghttp://roznamcha.blogspot.com/2009/05/search-by-id-is-dead-long-live-search.htmlnoreply@blogger.com (Sorin)0tag:blogger.com,1999:blog-27407738.post-3392908652880252558Tue, 28 Apr 2009 17:17:00 +00002009-04-28T19:00:44.837+01:00FreeMicroStrategyNot within a month after the release of Free Reporting Suite (that's what MicroStrategy, Inc calls the free BI product), MicroStrategy, Inc. is giving away the must have features finally absolutely free. I user named rich Arriaga pointed out the same to me. First, I disbelieved, but I see that there are lot of change on the site itself. But one image showing that you need to pay for must have http://roznamcha.blogspot.com/2009/04/microstrategy-license-is-absolutely.htmlnoreply@blogger.com (Ashish Tiwari)2tag:blogger.com,1999:blog-27407738.post-7029065781474694326Tue, 28 Apr 2009 12:05:00 +00002009-05-08T06:37:21.248+01:00Scenario:Attribute1 is a compound key attribute with a ginormous number of values. In fact, there are so many values that when you attempt to see all its elements, you get a spool space error.You also have a list of a few hundred elements (ID1 and ID2) belonging to this attribute and you somehow must build a report that would only show results for these elements.Deal breaker:As mentioned before, http://roznamcha.blogspot.com/2009/04/filtering-compound-attributes.htmlnoreply@blogger.com (Sorin)0tag:blogger.com,1999:blog-27407738.post-1443619436209451448Sun, 26 Apr 2009 13:15:00 +00002009-04-26T08:46:45.617+01:00CPULicenseMicroStrategyThis is wrt WindowsAs per the MicroStratey license, product can not be installed on a machine having more number of CPUs then licensed. OS system sees each core of CPU is seen as separate CPU. don't know what's the case with MicroStrategy. (As per the definitions document of MicroStrategy license)But tech notes are very contradicting. MicroStrategy Intelligence Server is limited to the http://roznamcha.blogspot.com/2009/04/1cpu-installation-on-multi-core-cpu.htmlnoreply@blogger.com (Ashish Tiwari)0tag:blogger.com,1999:blog-27407738.post-2044505335397876838Sat, 25 Apr 2009 12:50:00 +00002009-04-30T11:56:52.507+01:00CostLicenseMicroStrategyI would recommend you NOT jump from you seat by reading the word FREE. If you are a person who is a stakeholder for purchase decision of a BI product, you must be knowing it well that Nothing comes free in life.Remember following things:The MicroStrategy Reporting Suite may only be used for new MicroStrategy projects. Thus, products downloaded as part of the MicroStrategy Reporting Suite may not http://roznamcha.blogspot.com/2009/04/free-microstrategy-license-should-you.htmlnoreply@blogger.com (Ashish Tiwari)2tag:blogger.com,1999:blog-27407738.post-1649774789277479219Fri, 24 Apr 2009 18:47:00 +00002009-04-24T20:07:31.986+01:00EducationLearnMicroStrategy5 very informative online videos to learn basics of MicroStrategy. Deserve a dekho.Set Up and Configure the ServerDesign Attributes and HierarchiesDesign Metrics, Filters, and PromptsAdd UsersGo Live on the WebCheck out all videos here.There is a Chines proverb - A Picture can say 1000 wordsand Indian upgrade - video can say 1000000 words ;-)Last but not least, you can learn MicroStrategy of you http://roznamcha.blogspot.com/2009/04/microstrategy-basic-for-dummies.htmlnoreply@blogger.com (Ashish Tiwari)11tag:blogger.com,1999:blog-27407738.post-6830519971378273752Wed, 22 Apr 2009 17:14:00 +00002009-04-24T15:40:43.451+01:00CertificationExamMicroStrategyNarrowcast Server __________________ is responsible for the creation, formatting, transmission and administration of information services. ________________ is responsible for the gathering of user profiles and preferences through a web-based subscription site. Narrowcast Server information transmitters transmit services using _________ and _________. Which of the http://roznamcha.blogspot.com/2009/04/questions-for-narrowcast-server.htmlnoreply@blogger.com (Ashish Tiwari)2tag:blogger.com,1999:blog-27407738.post-1117342735149818074Wed, 22 Apr 2009 04:43:00 +00002009-04-22T05:43:55.622+01:00don'tmetric aliasesODBC errorThis is a little “don’t” that I stumbled upon recently.Don’t create metric aliases that contain operators such as “-“, “+”, and so long. Although MicroStrategy allows you to do so, the database application (Oracle, Teradata,…) will nag you about expecting “something between – and ,” and of course, the report will stop executing.http://roznamcha.blogspot.com/2009/04/metric-aliases.htmlnoreply@blogger.com (Sorin)1tag:blogger.com,1999:blog-27407738.post-6664058600768115996Sun, 19 Apr 2009 12:37:00 +00002009-04-21T15:14:15.270+01:00FreeMicroStrategyFinally MicroStrategy has woken up the truth and I must say my blog is definitely a contributor for them (MicroStrategy employees form a very good amount of user of this blog, specially the tech support).One needs to create a MicroStrategy account before downloading. Account creation is 100% free, no need to have purchased MicroStrategy. (If you are a MicroStrategy professional, you can create a http://roznamcha.blogspot.com/2009/04/free-microstrategy-license.htmlnoreply@blogger.com (Ashish Tiwari)5tag:blogger.com,1999:blog-27407738.post-4352778634219328457Fri, 03 Apr 2009 19:21:00 +00002009-04-03T20:23:45.923+01:00LinkedInI've created a LinkedIn poll to know what's the most significant role you are playing in the current MicroStrategy project you are working on. Poll here.http://roznamcha.blogspot.com/2009/04/you-most-significant-role-in-current.htmlnoreply@blogger.com (Ashish Tiwari)0tag:blogger.com,1999:blog-27407738.post-248043819219727389Fri, 03 Apr 2009 14:54:00 +00002009-04-03T15:56:43.379+01:00CognosMicroStrategyAshish Shah, a friend, has posted comparison between MicroStrategy and Cognos, on my MicroStrategy forum. Have a look.http://roznamcha.blogspot.com/2009/04/good-comparision-betwwen-microstrategy.htmlnoreply@blogger.com (Ashish Tiwari)0tag:blogger.com,1999:blog-27407738.post-1713203631523883506Wed, 01 Apr 2009 15:31:00 +00002009-04-01T16:38:14.451+01:00MicroStrategyScanMDeven if you don't have version 9 of MicroStrategy, just get it. ScanMD update which has come up after ages (not like frequent HF, SP or GA of MicroStrategy). It is toooooo good, even though I have't used yet. Have a look at the tech-note to downlaod new version.The biggest problem with ScanMD is it would show you tons of errors even though there is just ONE discrepiency in your metadata. So, http://roznamcha.blogspot.com/2009/04/scanmd-for-microstrategy-9-launched.htmlnoreply@blogger.com (Ashish Tiwari)0tag:blogger.com,1999:blog-27407738.post-8609574119145897738Wed, 01 Apr 2009 15:27:00 +00002009-05-13T08:54:45.274+01:00Errorm3objexp.ocxMicroStrategyInstalled MicroStrategy 9 just now only to seee that it doesn't work for some file compitability issue. Screenshot attached. :-( Will post images when have this error rectified.http://roznamcha.blogspot.com/2009/04/microstrategy-9-doesnt-work.htmlnoreply@blogger.com (Ashish Tiwari)9tag:blogger.com,1999:blog-27407738.post-4588539420759370541Tue, 31 Mar 2009 01:44:00 +00002009-03-31T02:45:48.901+01:00Join and Post only MicroStrategy Jobs related news, openings in this group microstrategyjobs@googlegroups.com http://roznamcha.blogspot.com/2009/03/microstrategy-jobs.htmlnoreply@blogger.com (Unknown)0tag:blogger.com,1999:blog-27407738.post-8146178629828222387Mon, 30 Mar 2009 03:19:00 +00002009-03-30T04:20:54.560+01:00So, what’s new?You can now export direct and recurring dependents of an object. That’s all.Now for some background…Direct dependents are the dependents found in MicroStrategy by right clicking on an object and selecting “Search for Dependents…”. The main difference is that Search By ID v2 exports them to an Excel file, whereas Desktop only allows the export to a non user friendly txt http://roznamcha.blogspot.com/2009/03/search-by-id-v2.htmlnoreply@blogger.com (Sorin)2tag:blogger.com,1999:blog-27407738.post-6672128845253718188Mon, 23 Mar 2009 09:59:00 +00002009-03-23T10:06:11.606+00:00Complex graph like 'combination: Dual Axis - Bar - line' graph cannot be created in Dashboard in WEB.To achieve the same, create a report in desktop and make as above mentioned graph and save.In WEB, while creating dashboard, add this data set in dashboard by 'right click' data set and add with formatting option. Now the graph which cannot be done in web, can be done in this way.http://roznamcha.blogspot.com/2009/03/complex-graph-in-dashboard-creation-in.htmlnoreply@blogger.com (Unknown)0tag:blogger.com,1999:blog-27407738.post-8653556088973445778Thu, 19 Mar 2009 06:54:00 +00002009-03-19T06:57:15.927+00:00ErrorMD DoctorMetadataMicroStrategyScanMDWhile working on metadata, there are chances that MD may get corrupt. Only reason for corruption of MD is MicroStrategy programmers NOT you (No way), unless you have manually fiddled with the metadata. One small change can messed the metadata forever, some time impossible to recover.There are two types of discrepancies in MicroStrategyLogicalPhysicalScanMD is used to recover from Logical http://roznamcha.blogspot.com/2009/03/scan-md-and-md-doctor.htmlnoreply@blogger.com (Ashish Tiwari)1tag:blogger.com,1999:blog-27407738.post-4459090970468906373Tue, 17 Mar 2009 05:34:00 +00002009-03-17T05:38:20.731+00:00Last month Jeremy wrote an excellent article on how filters can return unexpected results. My colleague Oznur found a somewhat similar issue and he was kind enough to allow me to share it with you.So, there was this tiny little report that used an element prompt, and that prompt contained a list of default answers. Nothing fancy so far. However, it has come to my colleague’s attention that this http://roznamcha.blogspot.com/2009/03/sluggish-prompts.htmlnoreply@blogger.com (Sorin)5tag:blogger.com,1999:blog-27407738.post-5095035867185530750Tue, 10 Mar 2009 10:03:00 +00002009-03-13T06:28:58.604+00:00InterviewMicroStrategy77. Can you update a table in Warehouse using MicroStrategy?78. attribute role, Security role, security filter and access control ?79. How will you resolve an issue when (by chance) a aggregate table at higher level has a higher LTS than an aggregate table at lower level? What happens if LTS is high for a hight level table?80. What are the criteria used by the MicroStrategy SQL Engine to build http://roznamcha.blogspot.com/2009/03/microstrategy-interview-questions-101.htmlnoreply@blogger.com (Ashish Tiwari)4tag:blogger.com,1999:blog-27407738.post-6421649077828573275Thu, 05 Mar 2009 02:59:00 +00002009-03-05T03:00:33.900+00:00Reminder: MicroStrategy 8.0.x Support Expiration Support for MicroStrategy 8.0.x officially expires on April 2, 2009.According to MSTR: If you are still running this version, upgrade planning and implementation services are available through MicroStrategy Consulting and can be requested through your Account Manager. If you are unable to get upgraded before the version expiration, please contact http://roznamcha.blogspot.com/2009/03/microstrategy-80x-support-expiration.htmlnoreply@blogger.com (Unknown)0