tag:blogger.com,1999:blog-7939785626617459865Tue, 08 Nov 2022 06:29:39 +0000Made from ScratchallrecipecraftsHands-OnArt Licensingpaintinghandmade giftsFoodie Findsartful livinghome decorpapercraftsArtful Living at HomeTechnical SavvyfabricherbsstencilingGiftablesTutorialsspicesArt and DesignQuiltingRebecca Baerpainting techniquequiltChristmasStudio ebreadcookinggildingpoultrysoupwebTutorialWhimsies & Wishesaccessoriesartbeefbusinessfishfoodgold leafkitchenoptimizing imagespastaphotoshopporkrubber stampsvegetablesBurlapCell Phone AccessoriesCell Phone PouchChalkboardFelting ToolsHamIpod pouchKaleLabelMagazineNeedle FeltingPaint BrushesPaintWorksPaper GoodsParty GoodsPillowRoc-lonSecrets2SuccessSnowThirstystone CoastersValentineWinterWool Rovingcheesecrystalsdisplayfarmer's marketflowersgemsgifts from the kitchenhagerstownhot fixmarylandpreservingspringsummerRebecca Baer® Artful Living | Creative resources and inspirationshttps://rebeccabaerartfulliving.blogspot.com/noreply@blogger.com (Rebecca)Blogger72125tag:blogger.com,1999:blog-7939785626617459865.post-8491322410979627508Thu, 05 Feb 2015 14:59:00 +00002017-08-15T18:23:45.492-04:00Art and Design Of the many things that keep me busy, sharing discoveries on this blog is one that I enjoy.  On the other hand I spend countless hours photographing, formatting and composing what appears here.  In addition to this blog I maintain several websites including my eCommerce site RebeccaBaer.com, my art licensing site RebeccaBaer.net (okay, so I'm not terribly original with those website names),https://rebeccabaerartfulliving.blogspot.com/2015/02/focus-focus-focus.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-5285418220625621471Wed, 28 May 2014 23:57:00 +00002014-05-28T19:58:02.922-04:00Art LicensingOur experience as first-time exhibitors in 2014. Booth Design Prior to the show we had to decide how to approach our booth design.  There are varied ways that exhibitors choose to outfit their booth.  Some artists treat it as a singular display with an overall theme showcasing one collection or look.  Other artists and most (if not all) agencies feature a variety of art on their walls.  Thehttps://rebeccabaerartfulliving.blogspot.com/2014/05/surtex-art-licensing.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-8259450339279001492Fri, 21 Mar 2014 16:10:00 +00002015-03-25T18:09:27.820-04:00Hands-OnPaint BrushespaintingTechnical Savvy You've been painting for years and are likely to have an enormous stash of brushes.  You've recently decided to expand your horizons and try a new medium.  Or perhaps you are just getting started and aren't sure which medium will speak to you.  You've heard talk that you should have a different set of brushes for each medium but you are hesitant--surely that advice is from a company or https://rebeccabaerartfulliving.blogspot.com/2014/03/do-i-really-need-duplicate-brushes.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-8547303317571214793Thu, 30 Jan 2014 14:00:00 +00002015-03-25T18:09:58.998-04:00accessoriesartful livingBurlapfabrichandmade giftsHands-Onhome decorMagazinepaintingpainting techniquePaintWorksPillowRebecca BaerRoc-lonstenciling This tutorial provides instructions for creating the companion pillows appearing in PaintWorks Magazine April 2014 Issue.  The magazine article features the rectangular pillow with the hand-painted dogwood blossoms panel.  The decorative panel overlay is attached with buttons allowing you to change it with the seasons. I have provided you with the total fabric requirements at the beginning https://rebeccabaerartfulliving.blogspot.com/2014/01/burlap-pillow-ensemble.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-5200431746650347973Fri, 24 Jan 2014 22:08:00 +00002015-03-25T18:10:35.786-04:00artArt Licensingcraftscrystalsgemshot fixRebecca Baerrubber stampsValentineWhimsies & Wishes Valentine's Day and everyday romance!  All you need is love.  Love is all you need. Are you ready to show someone just how much you care?  We can help with our new Gourmet Rubber Stamps!  Whether you are looking for just the right sentiment or a fun, whimsical image there are a range from which to choose.  These will carry you through Valentine's Day and beyond.  Ourhttps://rebeccabaerartfulliving.blogspot.com/2014/01/new-valentine-stamps.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-7041492476985447492Sun, 22 Dec 2013 14:31:00 +00002015-03-25T18:11:33.831-04:00Art LicensingChristmasfabrichagerstownmarylandquiltQuiltingRebecca BaerSnowWhimsies & WishesWinterImmerse yourself in a frosty winter wonderland in beautiful shades of grey.  The neutral tones lend an air of sophistication to this collection accented with finishing touches of metallic gold.  This group will ship in May 2014 allowing time to create all of your wintry projects.  Preview the Crystal Palace collection here. "Studio e" produces 100% cotton, premium quality fabrics in 43"/44" https://rebeccabaerartfulliving.blogspot.com/2013/12/crystal-palace-by-whimsies-wishes-for.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-2011270802236481395Sun, 03 Nov 2013 13:39:00 +00002015-03-25T18:12:32.175-04:00artful livingcraftsdisplayHands-On Whether your workspace is a table or a countertop you can add a convenient storage rail using common items found at the hardware store.  In keeping with the vintage look of the zinc counter in our studio/store we opted to use electrical conduit.  Connectors are available if the length of your workspace exceeds the length of the conduit but we chose to use the connectors as end caps so that the https://rebeccabaerartfulliving.blogspot.com/2013/11/creating-storage-rail.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-8782546434706627668Wed, 02 Oct 2013 00:48:00 +00002017-06-23T14:54:15.393-04:00breadMade from Scratchrecipe As I was making bread the other day I was lamenting the fact that I could only make a limited number of buns at one time.  I have always used my small cheesecake pans and only have six so I couldn't make buns en masse with enough to freeze for later use.  As I was trolling the kitchen to see what else I may be able to use I spied a wide mouth canning jar lid and thought it was worth a try.https://rebeccabaerartfulliving.blogspot.com/2012/12/create-instant-hamburger-bun-pan.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-1976562128299751903Wed, 11 Sep 2013 11:47:00 +00002018-03-07T07:34:57.676-05:00artArt LicensingChristmascraftsrubber stamps I'm excited to be able to share our new line of "Whimsies & Wishes™" stamps licensed to Gourmet Rubber Stamps.  These American made stamps are deeply-etched rubber backed with 1/8" thick cling mounting cushion.    Expanded Use  This initial release encompasses winter, celebration and Christmas icons.  The celebration icons, party hat, mask, noise makers, champagne flutes, etc., can behttps://rebeccabaerartfulliving.blogspot.com/2013/09/gourmet-rubber-stamps-whimsies-wishes.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-3670526395706773545Mon, 03 Jun 2013 20:22:00 +00002017-06-23T14:50:46.902-04:00Made from Scratchporkrecipesoup This soup is rich in flavor and oh-so-easy.  Once you brown the bacon and saute the onion and garlic it can all be thrown in a crock pot or finished in the same pot you used for browning.  Just be sure and use a large pot from the start so there is room for the remaining ingredients. When working on this recipe I experimented with different brands of bacon thinking perhaps any bacon would dohttps://rebeccabaerartfulliving.blogspot.com/2012/11/transylvanian-sausage-soup.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-4241002920851384258Sun, 02 Jun 2013 14:44:00 +00002017-06-22T07:34:42.656-04:00HamKaleMade from Scratchrecipe On a mission to create something unique using leftover baked ham I incorporated crispy roasted kale (the brainchild of my youngest) and a made-from-scratch honey mustard dressing along with a few other ingredients.  Of course, Ham is best friends with both greens and honey mustard and feta pairs nicely with onion so this was bound to be a winner! Roasted Kale The amount of https://rebeccabaerartfulliving.blogspot.com/2013/06/roasted-kale-ham-flatbread.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-5143457517870220810Thu, 23 May 2013 23:21:00 +00002015-03-25T18:15:45.919-04:00Art LicensingquiltQuiltingRebecca BaerStudio e My most recent fabric collection made its debut at the May 2013 Quilt Market.  Studio e made a lovely banner featuring the collection.  It was on display in their booth and is shown at right.   Paisley Romance is scheduled to ship in October so you are sure to be ready for Valentine and anytime romance.  The collection is full of loose watercolor-style roses, paisley, polkadots and gingham.  Thehttps://rebeccabaerartfulliving.blogspot.com/2013/05/paisley-romance-released-at-may-quilt.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-3925028370013870387Thu, 07 Mar 2013 12:15:00 +00002017-08-21T09:27:17.497-04:00Foodie Finds It is always a pleasure to find fresh food, made from scratch.  On a journey that took us through Utah we discovered a small restaurant/bakery featuring French fare.  Upon entering we received a friendly greeting and were quickly offered a seat.  It was a Sunday and so the featured menu was brunch served from eleven to three.  We were presented with fresh, hot wheat rolls (sourdough was alsohttps://rebeccabaerartfulliving.blogspot.com/2013/03/la-boulangerie-marie-cedar-city-utah.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-3623319283082622757Sun, 17 Feb 2013 22:52:00 +00002015-03-25T18:18:12.308-04:00Artful Living at HomeChalkboardHands-Onhome decorLabelpainting Some products come in the cutest jars and bottles so I hate to discard them. When it comes to labeling I often write directly on the jar with a sharpie.  It's convenient and easy to remove but, depending on the contents, can be hard to see (not to mention less than attractive) so I decided to create a label stencil.  The stencil includes eight silhouettes in a variety of shapes and sizes (somehttps://rebeccabaerartfulliving.blogspot.com/2013/02/upcycle-jars-with-stenciled-chalkboard.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-6654491544200573766Thu, 14 Feb 2013 10:38:00 +00002015-03-25T18:18:43.174-04:00Art LicensingfabricquiltQuiltingStudio e In the blink of an eye!  Most of the time the world of licensing and manufacturing moves pretty slowly (a lot of hurry up and wait) so you've gotta love it when a project comes together quickly. It probably helps that this collection is a single design produced in multiple colorways.  Since striking out on my own at the start of the new year* I have had a Whimsies & Wishes™ scroll pattern https://rebeccabaerartfulliving.blogspot.com/2013/02/pirouette-by-whimsies-wishes-for-studio.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-1554536028298359169Sun, 10 Feb 2013 15:29:00 +00002015-03-25T18:19:11.452-04:00Art LicensingGiftableshome decor On a recent whirlwind trip to America's Mart in Atlanta, Georgia I had the pleasure of seeing my new Key West collection produced by Highland Graphics.  These photos taken (with permission) in their showroom show the range of products in this group including glass cutting boards, serving trays, coasters, mugs, trivet, clock, dip chiller, etc.  What a thrill to see my own artwork on a collection https://rebeccabaerartfulliving.blogspot.com/2013/02/my-key-west-collection-at-americas-mart.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-200283064774955477Fri, 07 Dec 2012 23:53:00 +00002015-03-25T18:19:52.028-04:00Art LicensingbusinessSecrets2Success Have you ever wondered what people are saying about you, your brand, or products?  One way to monitor this would be to "google" these items occasionally and see what comes up but there is an easier way to keep your finger on the pulse of Google.   If you have a Google account you can select specific words and create a "Google Alert" for each.  Google then monitors itself based on your alert https://rebeccabaerartfulliving.blogspot.com/2012/12/managing-your-brand-with-google-alerts.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-1199687316210963472Fri, 30 Nov 2012 02:32:00 +00002017-08-21T08:52:48.210-04:00Foodie Finds Oh what a find! Eat More Cheese is a delightful haven for cheese lovers.  With a wide array of choices, ranging from creamy and delicious triple-creme Delice de Bourgogne to aged hard cheeses, this quaint shop is a delight for any cheese enthusiast.   At their new, larger store they now offer Proscuitto Pio Tosini, Speck, Pancetta and other sliced-to-order meats. The owners are a https://rebeccabaerartfulliving.blogspot.com/2012/11/eat-more-cheese-belfast-maine.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-8988149742949065667Wed, 07 Nov 2012 12:33:00 +00002015-03-25T18:20:55.679-04:00accessoriesCell Phone AccessoriesCell Phone PouchcraftsFelting ToolsGiftableshandmade giftsHands-OnIpod pouchNeedle FeltingWool RovingThis is such a fun and easy project.  Several can be completed in a single afternoon.  Begin by selecting from the precut pouches available Browse through the category as several styles are available including a plain version.  The standard pouch size fits an iphone 4S with a slim case.  Bulky cases do not fit.  However, you can request a larger case and provide dimensions for the device you wishhttps://rebeccabaerartfulliving.blogspot.com/2012/11/creating-felted-cell-phone-mp3-ipod_7.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-9147270154423430483Wed, 12 Sep 2012 02:12:00 +00002016-10-22T15:10:02.889-04:00allartful livingArtful Living at HomeHands-Onhome decorpainting The carpet runner over the oak flooring in our central hallway has definitely been showing some signs of age; even carpet gets wrinkles! Refinishing the floors (the same flooring flows from the hallway into most of the adjoining rooms) is definitely not in the budget nor practical from a time management standpoint so it is time to get creative.   Stained Floor We began by removing the https://rebeccabaerartfulliving.blogspot.com/2012/09/revitalize-oak-floor-with-paint.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-5445099103203782396Mon, 06 Aug 2012 02:35:00 +00002015-03-25T18:55:20.042-04:00Artful Living at HomecraftsfabricGiftableshandmade giftsHands-Onhome decor Instantly transform a variety of items by permanently covering them with fabric.  The fabric is fully saturated with an acrylic polymer with this technique so it thoroughly bonds with the surface creating a water-resistant barrier.  It can then be used as-is, painted, sealed and/or varnished.    Supplies needed for the Wet-Mount Process Surface  This tutorial depicts a glass plate from https://rebeccabaerartfulliving.blogspot.com/2012/08/mounting-fabric-wet-mount-method.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-7872588356444904369Sun, 15 Jul 2012 21:13:00 +00002017-06-23T14:55:55.582-04:00Made from Scratch Time Saving Strategies Ready to use Wash your leafy greens as soon as you get them. Freshly picked greens like spinach or lettuce can be downright muddy. Wash them in a basin full of cool water. Keep the batches small enough for the greens to move freely. Drain off the dirty water and repeat until the water is clear. Remove the greens to a towel and toss them to remove most of the water. https://rebeccabaerartfulliving.blogspot.com/2012/08/10-time-money-saving-strategies-for-cook.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-6440970208833584454Tue, 03 Jul 2012 10:32:00 +00002015-03-25T18:56:53.559-04:00Artful Living at HomecraftsfabricGiftableshandmade giftsHands-Onhome decor Mounting fabric on a firm substrate opens the door to all sorts of creative possibilities.  I've developed two methods for mounting fabric, a wet-mount method, which I will describe in another post, and a dry-mount method featured here.  Neither method requires any special tools.  Each method lends itself to particular uses and I will offer suggestions for which method would be preferred for a https://rebeccabaerartfulliving.blogspot.com/2012/07/mounting-fabric-dry-mount-method.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-1730820512747050596Thu, 28 Jun 2012 01:33:00 +00002017-06-23T14:56:39.251-04:00breadMade from Scratchrecipe Do you hate the dry, cardboard-like nature of store bought wheat bread?  Me too, which is why I don't buy it.  Instead, I make my own wheat bread with a fresh, wonderful flavor.  Like so many other things, I found that I don't dislike wheat bread; I dislike the mass-produced facsimile that passes for wheat bread.  What makes my bread so amazing, you might ask?  The secret is in the flour.  https://rebeccabaerartfulliving.blogspot.com/2012/02/homemade-wheat-bread-from-scratch.htmlnoreply@blogger.com (Rebecca)tag:blogger.com,1999:blog-7939785626617459865.post-7873522568131244984Thu, 10 May 2012 11:59:00 +00002015-03-25T19:06:35.599-04:00Art LicensingPaper GoodsParty Goods The Dove & Cross party goods are available in both pink and blue I am excited to be able to share the newest Whimsies & Wishes™ paper goods collection. Produced by Unique Industries, the collection consists of Large and small plates and napkins along with coordinating cups, table covers and more.   Matching balloons in a variety of themes, i.e., communion, baptism, no text, etc., arehttps://rebeccabaerartfulliving.blogspot.com/2012/05/whimsies-wishes-dove-cross-paper-goods.htmlnoreply@blogger.com (Rebecca)