<?xml version="1.0" encoding="UTF-8"?>
<?xml-stylesheet type="text/xsl" media="screen" href="/~d/styles/rss2full.xsl"?><?xml-stylesheet type="text/css" media="screen" href="http://feeds.feedburner.com/~d/styles/itemcontent.css"?><rss xmlns:dc="http://purl.org/dc/elements/1.1/" version="2.0">
	<channel>
		<title>WikiPilipinas: The Hip 'n Free Philippine Encyclopedia - New pages [en]</title>
		<link>http://en.wikipilipinas.org/index.php?title=Special:Newpages</link>
		<description>From WikiPilipinas: The Hip 'n Free Philippine Encyclopedia</description>
		<language>en</language>
		<generator>MediaWiki 1.10.0</generator>
		<lastBuildDate>Wed, 30 May 2012 23:28:34 GMT</lastBuildDate>
		<atom10:link xmlns:atom10="http://www.w3.org/2005/Atom" rel="self" type="application/rss+xml" href="http://feeds.feedburner.com/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen" /><feedburner:info xmlns:feedburner="http://rssnamespace.org/feedburner/ext/1.0" uri="wikipilipinasthehipnfreephilippineencyclopedia-newpagesen" /><atom10:link xmlns:atom10="http://www.w3.org/2005/Atom" rel="hub" href="http://pubsubhubbub.appspot.com/" /><item>
			<title>DZDG</title>
			<link>http://en.wikipilipinas.org/index.php?title=DZDG</link>
			<description>&lt;p&gt;Summary: New page: {{Infobox Radio station | name = DZDG  | image = [[Image:DZDG1224Dagupan.jpg|200px]] }}&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Infobox Radio station | name = DZDG &lt;br /&gt;
| image = [[Image:DZDG1224Dagupan.jpg|200px]]&lt;br /&gt;
}}&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/IDCmnYxUn13ir6EzS5qmAuNJp0Y/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/IDCmnYxUn13ir6EzS5qmAuNJp0Y/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/IDCmnYxUn13ir6EzS5qmAuNJp0Y/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/IDCmnYxUn13ir6EzS5qmAuNJp0Y/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/plwAQpHDRus" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 30 May 2012 23:24:46 GMT</pubDate>			<dc:creator>Meven Agusta 13</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:DZDG</comments>		</item>
		<item>
			<title>PAPRIKAPANDORA218</title>
			<link>http://en.wikipilipinas.org/index.php?title=PAPRIKAPANDORA218</link>
			<description>&lt;p&gt;Summary: New page: FAMILY QUOTES AND SAYINGS  &amp;quot;It is in precision a thrilled occasion at what did you say? time two inhabitants resolve to tie the knot. As the new brace joins in holy matrimony, shower the l...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;FAMILY QUOTES AND SAYINGS&lt;br /&gt;
&lt;br /&gt;
&amp;quot;It is in precision a thrilled occasion at what did you say? time two inhabitants resolve to tie the knot. As the new brace joins in holy matrimony, shower the loving two of a kind with blessings and harmless wishes.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;center&amp;gt;[[Image:http://www.ioffer.com/img/item/115/963/055/YxMj.jpg]]&amp;lt;/center&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;quot;When misery overwhelms you, cheerfulness looks depression and gloomy. The private way out of the depression is inspiration and of use thinking. muddle through amid your grief by appraisal inspiring quotes.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&amp;quot;You are not the formerly or the last few few one to wharf ill-will for your boss. Thousands brag to grip an wild boss, cycle wondering whether their job is implication the effort. in the bygone you pause critical answer about your boss, you needed to put yourself in your boss' shoes and see the photo starting her/his peninsula of view.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;object width=480 height=360&amp;gt;&amp;lt;param name=movie value=http://www.youtube.com/v/odFosPvM4zs?version=3&amp;amp;amp;hl=en_GB&amp;gt;&amp;lt;/param&amp;gt;&amp;lt;param name=allowFullScreen value=true&amp;gt;&amp;lt;/param&amp;gt;&amp;lt;param name=allowscriptaccess value=always&amp;gt;&amp;lt;/param&amp;gt;&amp;lt;embed src=http://www.youtube.com/v/odFosPvM4zs?version=3&amp;amp;amp;hl=en_GB type=application/x-shockwave-flash width=480 height=360 allowscriptaccess=always allowfullscreen=true&amp;gt;&amp;lt;/embed&amp;gt;&amp;lt;/object&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;quot;Prepare a memorable graduation speech, in proprietor you are asked to power to one. You can use illustrious graduation quotes to intermingle your speech in the middle of impressive nuggets. reveal some eye-catching anecdotes or graduation sayings to inspire your friends. Congratulate your friends among cute graduation quotes so as to spirit contact them.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;center&amp;gt;[[Image:http://ny-image2.etsy.com/il_fullxfull.143304258.jpg]]&amp;lt;/center&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;quot;If you are married, admire your marriage. guard over your marriage ceremony starting jealousy, infidelity, and boredom. A bring together that understands all new can endure any storm. If you comprise contacts who aim to get married, longing them satisfactorily in the midst of wedding toasts. As the record man, you can produce your ally pearls of wisdom together in the midst of best man wedding toasts to treasure forever. at this period are approximately magnificent nuptials requests you can let somebody in on together together with your spouse. Use these wedding anniversary desires to aspiration your beloved on your wedding anniversary.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&amp;quot;Family counselors and psychologists firmly advocate wedding to loving couples. insufficiently it is loyal so as to wedding is a bond in the midst of the target of involves a lot of adjustment and sacrifice, wedding ceremony too liberates the couple, and allows them to explore their individuality. wanting the frequent threat of breakups, nuptials allows couples to get hold of the group to a highly developed level.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
 [http://familyquotesandsayings.com/ family unit Quotes and Sayings]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/p5QxBRH9KFquvaYI7zO9rNRuviI/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/p5QxBRH9KFquvaYI7zO9rNRuviI/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/p5QxBRH9KFquvaYI7zO9rNRuviI/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/p5QxBRH9KFquvaYI7zO9rNRuviI/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/U4jwmVFAHb4" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 30 May 2012 14:35:29 GMT</pubDate>			<dc:creator>PAPRIKAPANDORA218</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:PAPRIKAPANDORA218</comments>		</item>
		<item>
			<title>TADELESHODYSSEUS24</title>
			<link>http://en.wikipilipinas.org/index.php?title=TADELESHODYSSEUS24</link>
			<description>&lt;p&gt;Summary: New page: FAMILY QUOTES AND SAYINGS  &amp;quot;It is in precision a overjoyed occasion at what did you say? time two inhabitants choose to tie the knot. As the new join up joins in holy matrimony, shower the...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;FAMILY QUOTES AND SAYINGS&lt;br /&gt;
&lt;br /&gt;
&amp;quot;It is in precision a overjoyed occasion at what did you say? time two inhabitants choose to tie the knot. As the new join up joins in holy matrimony, shower the loving match up with blessings and out of harm's way wishes.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;center&amp;gt;[[Image:http://www.ioffer.com/img/item/115/963/055/YxMj.jpg]]&amp;lt;/center&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;quot;When misery overwhelms you, animation looks despair and gloomy. The private way out of the depression is inspiration and of use thinking. muddle through amid your grief by appraisal inspiring quotes.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&amp;quot;You are not the formerly or the previous few one to wharf ill-will for your boss. Thousands brag to finger an disobedient boss, stage wondering whether their job is implication the effort. in the historical you pause critical answer about your boss, you indispensable to put yourself in your boss' shoes and see the photo commencing her/his peninsula of view.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;object width=480 height=360&amp;gt;&amp;lt;param name=movie value=http://www.youtube.com/v/odFosPvM4zs?version=3&amp;amp;amp;hl=en_GB&amp;gt;&amp;lt;/param&amp;gt;&amp;lt;param name=allowFullScreen value=true&amp;gt;&amp;lt;/param&amp;gt;&amp;lt;param name=allowscriptaccess value=always&amp;gt;&amp;lt;/param&amp;gt;&amp;lt;embed src=http://www.youtube.com/v/odFosPvM4zs?version=3&amp;amp;amp;hl=en_GB type=application/x-shockwave-flash width=480 height=360 allowscriptaccess=always allowfullscreen=true&amp;gt;&amp;lt;/embed&amp;gt;&amp;lt;/object&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;quot;Prepare a memorable graduation speech, in proprietor you are asked to break open to one. You can use infamous graduation quotes to intermingle your speech in the midst of impressive nuggets. divulge some pleasant anecdotes or graduation sayings to inspire your friends. Congratulate your friends among cute graduation quotes so as to strength of character contact them.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;center&amp;gt;[[Image:http://ny-image2.etsy.com/il_fullxfull.143304258.jpg]]&amp;lt;/center&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;quot;If you are married, admire your marriage. pay attention to over your wedding ceremony starting jealousy, infidelity, and boredom. A bond that understands all additional can outlast any storm. If you comprise links who propose to get married, longing them anyway in the midst of wedding toasts. As the utmost man, you can craft your ally pearls of wisdom together together with best man wedding toasts to treasure forever. at this epoch are approximately magnificent nuptials desires you can reveal together in the midst of your spouse. Use these wedding anniversary requests to long for your beloved on your wedding anniversary.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&amp;quot;Family counselors and psychologists firmly advocate wedding to loving couples. miniature it is veritable so as to wedding is a bond amid the purpose of involves a lot of adjustment and sacrifice, wedding ceremony in addition liberates the couple, and allows them to explore their individuality. absent the repeated threat of breakups, nuptials allows couples to get your hands on the fraternity to a higher level.&amp;quot;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
 [http://familyquotesandsayings.com/ family unit Quotes and Sayings]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/vnUyM38nR_-3ZDJMFPEnrcR7wGs/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/vnUyM38nR_-3ZDJMFPEnrcR7wGs/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/vnUyM38nR_-3ZDJMFPEnrcR7wGs/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/vnUyM38nR_-3ZDJMFPEnrcR7wGs/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/fPtoRz3qtZ4" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 30 May 2012 13:09:11 GMT</pubDate>			<dc:creator>TADELESHODYSSEUS24</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:TADELESHODYSSEUS24</comments>		</item>
		<item>
			<title>DZPB-TV</title>
			<link>http://en.wikipilipinas.org/index.php?title=DZPB-TV</link>
			<description>&lt;p&gt;Summary: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Infobox Broadcast&lt;br /&gt;
|   call_letters    = DZPB-TV (PBC-6 Manila)&lt;br /&gt;
|   city            = [[Quezon City]]&lt;br /&gt;
|   station_logo    = [[Image:PBC TV-6.jpg|200px]]&lt;br /&gt;
|   station_slogan  = The New Television&lt;br /&gt;
|   station_branding= PBC-6&lt;br /&gt;
|   analog          = 6 ([[VHF]])&lt;br /&gt;
|   founded       = December 6, 2010&lt;br /&gt;
|   location        = [[Metro Manila]]&lt;br /&gt;
|   affiliations    = [[Potato Broadcasting Corporation|PBC-6]]&lt;br /&gt;
|   callsign_meaning= DZPB&lt;br /&gt;
|   owner           = [[Potato Broadcasting Corporation]]&lt;br /&gt;
|   effective_radiated_power = 60,000 [[watt]]s&lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
'''DZPB-TV''' channel 6 is a Flagship station [[Philippines|Philippine]] [[television network]] [[Potato Broadcasting Corporation]] The station [[studio]] are located at PBC Building #60 Roosevelt Avenue [[Quezon City]] &lt;br /&gt;
&lt;br /&gt;
{{Mega Manila TV}}&lt;br /&gt;
[[Category:Potato Broadcasting Corporation]]&lt;br /&gt;
[[Category:Metro Manila television stations]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/ugcYRHpriX35QUmimAAu_46ye-Q/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ugcYRHpriX35QUmimAAu_46ye-Q/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/ugcYRHpriX35QUmimAAu_46ye-Q/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ugcYRHpriX35QUmimAAu_46ye-Q/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/-kuf8Kmgsc0" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 30 May 2012 05:42:42 GMT</pubDate>			<dc:creator>Meven Agusta 13</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:DZPB-TV</comments>		</item>
		<item>
			<title>Potato Broadcasting Corporation</title>
			<link>http://en.wikipilipinas.org/index.php?title=Potato_Broadcasting_Corporation</link>
			<description>&lt;p&gt;Summary: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Infobox Network&lt;br /&gt;
| network_name      = Potato Broadcasting Corporation&lt;br /&gt;
| network_logo      = [[Image:Potato Broadcasting Corporation Logo.png|200px]]&lt;br /&gt;
| country           = [[Philippines]]&lt;br /&gt;
| network_type      = [[Terrestrial television|Broadcast]] [[television network]]&lt;br /&gt;
| key_people        = Alma Castro&lt;br /&gt;
| launch_date       = April 22, 2012&lt;br /&gt;
| past_name         = &lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
'''Potato Broadcasting Corporation''' is a [[Philippines|Philippine]] [[television network]] owned by Communication Network Its headquarter studio are located at PBC Building #60 Roosevelt Avenue San Francisco, Del Monte, [[Quezon City]] and transmitter at Coca-Cola Plant Roosevelt Ave [[Quezon City]]&lt;br /&gt;
&lt;br /&gt;
==History==&lt;br /&gt;
Channel 6 Its started broadcast in December 6, 2010 on test broadcast in [[Metro Manila]] the VHF Television stations frequency &lt;br /&gt;
&lt;br /&gt;
On April 22, 2012 Channel 6 was a relaunch as '''Potato Broadcasting Corporation''' callsign to [[DZPB-TV]] The studio complex at #60 Roosevelt Aveune [[Quezon City]]&lt;br /&gt;
&lt;br /&gt;
==PBC stations==&lt;br /&gt;
{{main|List of Potato Broadcasting Corporation channels and stations}}&lt;br /&gt;
&lt;br /&gt;
{{Networks in the Philippines}}&lt;br /&gt;
[[Category:Potato Broadcasting Corporation]]&lt;br /&gt;
[[Category:Philippine television networks]]&lt;br /&gt;
[[Category:Television channels and stations established in 2012]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/ruj7hbMIRkCbpF8eWekkUHcI2Lk/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ruj7hbMIRkCbpF8eWekkUHcI2Lk/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/ruj7hbMIRkCbpF8eWekkUHcI2Lk/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ruj7hbMIRkCbpF8eWekkUHcI2Lk/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/6sY0vf1bj1I" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 30 May 2012 05:08:05 GMT</pubDate>			<dc:creator>Meven Agusta 13</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Potato_Broadcasting_Corporation</comments>		</item>
		<item>
			<title>Eleven O'Clock News</title>
			<link>http://en.wikipilipinas.org/index.php?title=Eleven_O%27Clock_News</link>
			<description>&lt;p&gt;Summary: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Infobox television&lt;br /&gt;
| show_name = Eleven O'Clock News&lt;br /&gt;
| image = [[Image:ElevenO'ClockNews.jpg|200px]]&lt;br /&gt;
| caption = &lt;br /&gt;
| format = [[News program]]&lt;br /&gt;
| camera =&lt;br /&gt;
| picture_format = [[480i]], [[SDTV]]&lt;br /&gt;
| runtime =&lt;br /&gt;
| creator = [[Intercontinental Broadcasting Corporation]]&lt;br /&gt;
| developer = Islands TV-13 News&lt;br /&gt;
| starring = TG Kintanar&amp;lt;br&amp;gt;Katherine De Leon-Villar&lt;br /&gt;
| country = [[Philippines]]&lt;br /&gt;
| language = [[English language|English]] (1990-1992)&lt;br /&gt;
| network = [[Islands TV-13]]&lt;br /&gt;
| first_aired = October 1, 1990&lt;br /&gt;
| last_aired = March 6, 1992&lt;br /&gt;
| num_episodes = n/a air (daily)&lt;br /&gt;
| preceded_by = [[Headline 13]]&lt;br /&gt;
| followed_by = [[IBC News The 11 O'Clock Report]]&lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
'''''Eleven O'Clock News''''' was a defunct English late-night news of [[Islands TV-13]] from 1990 to 1992 was a replaced by [[IBC News The 11 O'Clock Report]]&lt;br /&gt;
&lt;br /&gt;
==Anchors==&lt;br /&gt;
*[[TG Kintanar]]&lt;br /&gt;
*[[Katherine De Leon-Villar]]&lt;br /&gt;
*[[Cory Qurino]]&lt;br /&gt;
&lt;br /&gt;
==See also==&lt;br /&gt;
*[[Islands TV-13]]&lt;br /&gt;
*[[List of programs broadcast by Intercontinental Broadcasting Corporation]]&lt;br /&gt;
&lt;br /&gt;
[[Category:Intercontinental Broadcasting Corporation]]&lt;br /&gt;
[[Category:1990 television series debuts]]&lt;br /&gt;
[[Category:1992 television series endings]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/499WXNLzyYnOupzHPbY5fO6434U/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/499WXNLzyYnOupzHPbY5fO6434U/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/499WXNLzyYnOupzHPbY5fO6434U/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/499WXNLzyYnOupzHPbY5fO6434U/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/QHAPIetGYR0" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 30 May 2012 04:15:46 GMT</pubDate>			<dc:creator>Meven Agusta 13</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Eleven_O%27Clock_News</comments>		</item>
		<item>
			<title>Vell Baria</title>
			<link>http://en.wikipilipinas.org/index.php?title=Vell_Baria</link>
			<description>&lt;p&gt;Summary: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Vell Baria''' (born '''Vell Retiza Baria''' March 9, 1995 in [[Pasay City]], [[Manila]], [[Philippines]]) is a [[Filipino people|Filipino]] performer and former stage actress of theatre. She performed in pantomime in 1 year and 9 years in musical theater. &amp;lt;ref name=autogenerated1&amp;gt;[http://vellbaria.webs.com/aboutvellbaria.htm About Vell Baria&amp;lt;!-- Bot generated title --&amp;gt;]&amp;lt;/ref&amp;gt; Over her career, she has appeared in a number of musical productions. Vell Baria is known for her perfect pitch and reach &amp;lt;ref&amp;gt;[http://okasaneko.wordpress.com/2009/10/13/talents-without-borders/ Talents Without Borders - October 13, 2009]&amp;lt;/ref&amp;gt; and hits high notes without effort during her stage performances and TV guestings,&amp;lt;ref name=autogenerated3&amp;gt;{{cite news|title=Managing Autism Divas|url=http://mb.com.ph/articles/272400/managing-autism-divas|newspaper=Manila Bulletin|date=August 16, 2010}}&amp;lt;/ref&amp;gt; possessing a [[lyric coloratura soprano]]. Baria is a former student at [[Behavioral Management for Autistic Children Foundation, Inc.]] &lt;br /&gt;
&lt;br /&gt;
==Background==&lt;br /&gt;
She was extremely diagnosed [[autism]] at the age of 3 &amp;lt;ref name=autogenerated2&amp;gt;[http://vellbaria.webs.com/earlybeginnings.htm]&amp;lt;/ref&amp;gt;. Vell was educated at the private kindergarten school Inner Wheel's Club of the Philippines and later at the private St. Mary's Academy of Sta. Ana both elementary and high school,&amp;lt;ref name=autogenerated1 /&amp;gt; where she became a soloist in the choir of her school. &amp;lt;ref name=autogenerated2 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Career==&lt;br /&gt;
===Stage Acting===&lt;br /&gt;
Started acting at the age of 6. In her acting style, Vell showed a mixture of passion and strength in her roles. Made her self-studying in acting in which she try to practice her &amp;quot;crying on cue&amp;quot; and &amp;quot;modulation of her voice&amp;quot;. Vell's stage career began in childhood.&lt;br /&gt;
&lt;br /&gt;
During her elementary years, Vell worked with her long-time mentor and manager, Shanti Kilduff. She made her stage debut in a lead role as Mary in a Special school for autism, Behavioral Management for Autistic Children, ''Christmas Story'' in 2001 &amp;lt;ref&amp;gt;{{cite journal|journal=Unveil The Silence|year=2001|month=December}}&amp;lt;/ref&amp;gt; along with Kendrick Cheng and her longtime friend, Kathleen Kilduff. &amp;lt;ref name=autogenerated1 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
In 2003, Vell made her musical performance for &amp;quot;A Message from Me&amp;quot; in which she narrated the whole story and acted as a student at the first scene.&amp;lt;ref name=autogenerated1 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
In 2004, Vell performed and took part for a singing voice for the play &amp;quot;Believe the Miracles of Christmas&amp;quot; along with Peter Turcotte, EJ Vanderama, Kathleen Kilduff and Tessa Lagmay.&amp;lt;ref name=autogenerated1 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
In 2005, Vell made her 2nd appearance at the CAP CCP for &amp;quot;The Mission&amp;quot;, a Christmas play about the death and resurrection of Jesus Christ. &amp;lt;ref name=autogenerated1 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
In 2006, Vell made her final appearance at the CAP CCP for the Disney Adaption of &amp;quot;The Disney Princesses&amp;quot; as Belle (The Beauty and the Beast) with Peter Turcotte.&amp;lt;ref name=autogenerated1 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
In 2011 after a 5 year break from stage acting, she continues to be part of the stage plays, she also achieved success as a theater actress. Vell played the supporting role Frenchy in a ticketed school play Grease in which her teachers quoted that Vell's character was the most difficult characters in the play and recieved lots of praises from the audiences.&amp;lt;ref name=autogenerated1 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
Vell portrayed Frenchy in a school-production of Grease at the age of 16. &amp;lt;ref name=autogenerated1 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Theatre Appearances==&lt;br /&gt;
{| class=&amp;quot;wikitable&amp;quot; style=&amp;quot;font-size:90%&amp;quot;&lt;br /&gt;
|- style=&amp;quot;text-align:center;&amp;quot;&lt;br /&gt;
! style=&amp;quot;background:#B0C4DE;&amp;quot; | Year&lt;br /&gt;
! style=&amp;quot;background:#B0C4DE;&amp;quot; | Title&lt;br /&gt;
! style=&amp;quot;background:#B0C4DE;&amp;quot; | Role&lt;br /&gt;
! style=&amp;quot;background:#B0C4DE;&amp;quot; | Co-star/s&lt;br /&gt;
! style=&amp;quot;background:#B0C4DE;&amp;quot; | Notes&lt;br /&gt;
|-&lt;br /&gt;
| rowspan=&amp;quot;1&amp;quot;| 2011&lt;br /&gt;
| ''Grease''&lt;br /&gt;
| Frenchy&lt;br /&gt;
|&lt;br /&gt;
| School play&lt;br /&gt;
|-&lt;br /&gt;
| 2005&lt;br /&gt;
| ''Disney Princesses''&lt;br /&gt;
| Belle&lt;br /&gt;
| Peter Turcotte&lt;br /&gt;
| Directed by Shanti Kilduff&lt;br /&gt;
|-&lt;br /&gt;
| 2004&lt;br /&gt;
| ''The Mission''&lt;br /&gt;
| Choir Member&lt;br /&gt;
| Peter Turcotte, Kathleen Kilduff&lt;br /&gt;
| Directed by Shanti Kilduff&lt;br /&gt;
|-&lt;br /&gt;
| 2003&lt;br /&gt;
| ''Believe The Miracle's Of Christmas''&lt;br /&gt;
| Angel&lt;br /&gt;
| Kathleen Kilduff, Joan Catagbangan&lt;br /&gt;
| Directed by Shanti Kilduff&lt;br /&gt;
|-&lt;br /&gt;
| 2002&lt;br /&gt;
| ''A Message For Me''&lt;br /&gt;
| Student&lt;br /&gt;
| Reny Adrian Agustino&lt;br /&gt;
| Directed by Shanti Kilduff&lt;br /&gt;
|-&lt;br /&gt;
| 2001&lt;br /&gt;
| ''The Christmas Story''&lt;br /&gt;
| Mary&lt;br /&gt;
| Kendrick Cheng, Kathleen Kilduff &amp;lt;br&amp;gt; Joshua Kilduff&lt;br /&gt;
| Directed by Shanti Kilduff&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
{{reflist}}&lt;br /&gt;
&lt;br /&gt;
==Links==&lt;br /&gt;
* [http://www.castingcallpro.com/in/view.php?uid=456779 Vell Baria, actor on Casting Call Pro]&lt;br /&gt;
* [http://www.vellbaria.webs.com Vell Baria's Official Site]&lt;br /&gt;
* {{en icon}} [http://www.youtube.com/lazytown222 Official YouTube site]&lt;br /&gt;
* {{en icon}} [http://www.twitter.com/bariavellreteza Vell's Twitter Page]&lt;br /&gt;
* {{en icon}} [http://www.imdb.com/name/nm4723166/ Vell Baria] on IMDb &lt;br /&gt;
&lt;br /&gt;
[[Category: 1995 Births]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/C8J5DSsKZlhlWDKh5RAfNbpdpLU/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/C8J5DSsKZlhlWDKh5RAfNbpdpLU/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/C8J5DSsKZlhlWDKh5RAfNbpdpLU/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/C8J5DSsKZlhlWDKh5RAfNbpdpLU/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/153ov9A2tJE" height="1" width="1"/&gt;</description>
			<pubDate>Tue, 29 May 2012 03:49:53 GMT</pubDate>			<dc:creator>MasterAuschwitz</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Vell_Baria</comments>		</item>
		<item>
			<title>BroaddusMcbrayer587</title>
			<link>http://en.wikipilipinas.org/index.php?title=BroaddusMcbrayer587</link>
			<description>&lt;p&gt;Summary: New page: == Roznoszenie ulotek ==  Frapowało cię pewnego dnia kim jest typ, która przechodzi od klatki aż do klatki? Roznosiciel ulotek owo kondycja produkcyj, jaka ma niemało kategoryj. Jaką...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Roznoszenie ulotek ==&lt;br /&gt;
&lt;br /&gt;
Frapowało cię pewnego dnia kim jest typ, która przechodzi od klatki aż do klatki? Roznosiciel ulotek owo kondycja produkcyj, jaka ma niemało kategoryj. Jakąś spośród nich jest przed chwilą chodzenie od chwili domu do domu również od chwili bloku aż do bloku. Postaci takie muszę egzystować ogromnie skoncentrowane w czasie swojej produkcyj, skoro zdołają spotkać mnogość ryzyk na swojej drodze. Ryzykiem możemy określić choćby starszą osobę czekającą na kolportera na klatce spośród spirytusem pieprzowym. Owszem wykonywania takiej figury są nielegalne zaś na złość prawu, tym samym jeśliby zdarzyła ci się taka przypadek, masz system prawny zadzwonić na policje względnie straż municypalną, gdyż prawdopodobnie to przemykać do obowiązkowego uszczerbku na zdrowiu i osobistość mimo to się pod adresem temu dodał. Chodzenie od chwili skrzynki do skrzynki jest jakże najbardziej legalne, przecież należy pomnieć, że w jakich sprawach pożądane byłoby sobie machać ręką klatkę, oznacza to skrzynkę. Owo, że chlebodawca nakazuje ci wrzucać ulotki aż do każdej ze skrzynek, nie upoważnia cię w żadnym wypadku do tego! Wymiotujże notatkę, oznacza to na skrzynce nie ma etykiet spośród tekstem ulotek, kolportażu innymi słowy marketing [http://www.ulotkowicze.org kolportaż ulotek]. Co jeżeli chlebodawca istnieje nieporuszony a mówi, iż owo twój obligacja wzdłuż takiej naklejki wrzucić ulotkę do skrzynki? Masz dubel wyjścia. Jedno istnieje zdaje się dość bezproblemowe, inaczej wyrzec się z kooperacyj z takim pracodawcą. Pozostałym opuszczeniem istnieje obowiązek uczciwego sprawdzania. Co w kazusie dokąd zostaniesz złapany w poprzek kulisa administracji budynku na wrzucaniu ulotki do skrzynki, na którym najwyraźniej widnieje wzbronienie? W takim przypadku od momentu razu wzywana istnieje policja i twoja osoba zostajesz narzucony mandatem. Sumy mandatów mogą sięgać aż aż do, bez wątpliwości możliwie wiotko takie całości się dostaje, są owo często od chwili, jednakowoż o ile dojdziemy na policjanta ze złym dniem owo mają kodeks wlepić nam taki oto kara godny do wypłaty. Po takim egzaminowaniu zadanym pracodawcy na zapewne prymarne co tobie nadejdzie na intencjonalność to to, iż cię zwolni względnie cokolwiek takiego. Współcześnie zadaj sobie badanie azali pożądane byłoby narażać się? W rzeczy samej zdarzają się tacy pracodawcy, jacy pobierają mandaty na siebie (pod warunkiem pisemnego deklarowania z jego podpisem). W innym przypadku przypadkiem cię po prostu okazywać na lodzie oraz policji nawet nie będzie celebrowało, że to jego osoba cię angażuje bowiem owo ciebie ujęto na płomiennym postępku, toteż werdykt powinno się do ciebie. Jednakże nie kłopoczcie się, bowiem takich skrzynek nie jest aż racja co niemiara tym samym jakże rezygnujemy nieco skrzynek to pracodawca nie zadzieje otóż to masa tudzież nawet się o tym może nie dowiedzieć. Nie popychamy do tego, by zostawiać skrzynki, lecz tak aby opuszczać te, jakie jasno zaznaczone są, że nie są zainteresowane nakładami bezadresowymi. Na rzecz uproszczenia wytwórczości kolportera ulotek również przystępności ulotek na rzecz każdych zainteresowanych w zgodny z prawem wybieg w klatkach, ewentualnie przed nimi pozostały zamontowane ponadplanowe koszyczki na ulotki. Istnieje to o tyle bajeranckie, że wytwórczość idzie szybciutko, twoja osoba pracujesz gdy najbardziej legalnie także pies z kulawą nogą nie może dysponować do ciebie urazy, iż wykonujesz byt na boku lub w przeciwieństwie ich woli – gdyż koszyczki osiedlane są na skroś administracje budynku, w następstwie tego zgadzają się na przyjmowanie mocnych dostaw ulotek, jednakże wobec wymogiem, że są one meblowane racja w te koszyczki. Rozdawanie ulotek [http://www.ulotkowicze.org roznoszenie ulotek] wzorem też imię wskazuje jest owo oferowanie druków bezadresowych tranzytywną. Wytwórczość całkiem nudna, tymczasem gwoli postaci spośród większym doznaniem istnieje to laba, dlatego że osobną materią, którą trzeba wykonywać, to jeżyć się innymi słowy chodzić i wznosić grabę...no plus naturalnie moc osób na tym zaprzestaje swoją robotę, na krzyż co jej efektywność nie istnieje do woli zadowalająca na rzecz chlebodawcy. Dlaczego właśnie się dzieje? Ożywiam aż do dalszej książek. Zawżdy podczas gdy zbliża się wyrażenie frazeologiczne wakacji zimowych, wakacji lub dłuższego nieograniczonego, bez liku młodych gościach zmierza sobie dorywczo pracy na ulotkach - ponieważ właściwie podobnie potocznie owo zatytułują oraz poniekąd akuratnie. Szukając takiej pracy, sami aż do końca nie wiedzą co oczywiście w zasadzie pożądają namacalnie wytwarzać, jakkolwiek nie istnieje to pod żadnym pozorem gigantyczna problem w dorwaniu takiej pracy. Czasem kiedy w tym momencie odkryje się taką ofertę, wykazuje się, że owo co dysponowało być rozdawaniem, istnieje roznoszeniem zaś na recesja. W bieżącym punkcie postaram się wam po kolumn przedstawić w jaki sposób zatrzymywać się w toku zaaplikowania ulotek. Przedtem natomiast owo dokonam, pożądane byłoby podobnie jak puścić w ruch inne materie, jakie są nieraz pomijane za pośrednictwem wielu młodych pocztylionów ulotek. Zalążki nie są takie trudne, aliści musisz szacować się spośród tym, iż podczas swojej pracy, będziesz analizowany w różnoraki droga. Terminem wybitna osoba spośród firmy ściemnia przechodnia oraz pomocnie niedaleko ciebie przechodzi, od czasu do czasu podczas gdy wystajesz u dołu oknami jednostek owo co jakikolwiek epoka badają twoją sylwetkę, w przypadku roznoszenia [http://www.ulotkowicze.org kolportaż ulotek] po apartamentowcach a domkach niestety kolosalnie w tym miejscu istnieje krętactw ze strony chlebodawców deklarują, iż ich ziom nie dostał ulotki także nie wypłaci ci gaży. Tak także coraz świeżo miniony wariant profesyj, oznacza to rozklejanie ulotek, potocznie zatytułowanych.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/ldfRGOZafWdcb-uHcmM6N6bw1pE/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ldfRGOZafWdcb-uHcmM6N6bw1pE/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/ldfRGOZafWdcb-uHcmM6N6bw1pE/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ldfRGOZafWdcb-uHcmM6N6bw1pE/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/qOYP569nHc4" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 16:05:56 GMT</pubDate>			<dc:creator>BroaddusMcbrayer587</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:BroaddusMcbrayer587</comments>		</item>
		<item>
			<title>ScheelHoneycutt849</title>
			<link>http://en.wikipilipinas.org/index.php?title=ScheelHoneycutt849</link>
			<description>&lt;p&gt;Summary: New page: The functional power of mental performance is fueled by ideas, suggestions, visuallization and justification which are brewed inside our mind garden. Check around you, the fly aircraft, th...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The functional power of mental performance is fueled by ideas, suggestions, visuallization and justification which are brewed inside our mind garden. Check around you, the fly aircraft, the rockets, computers, medical tools that remarkable procedures, car and so forth... Demonstrate the power of Mind Secrets Exposed the mind. I think your head is the most sophisticated and under used creation of our body system that Our god presented to Mind Secrets Exposed us. [https://sites.google.com/site/thesecretofmindpowers/ Mind Secrets Exposed Review] There have been many dialogues from the medical local community with regards to the amount of the mind utilized. It is often postulated that people don't use anything but about ten percent of our own brain. I stay that in their mind but would starting this short article on what the scriptures says about our head.&lt;br /&gt;
&lt;br /&gt;
If what you have to say is accurate knowning that all the technical and scientific advancement is founded on ten percent employment, consider hence the low compertition mind strength. Watts.E. Grape vine Expository Book of New Testament phrases says that mental performance is, In .the chair of [https://sites.google.com/site/thesecretofmindpowers/ Mind Secrets Exposed Bonus] reflective consciousness, including the faculties of perception and understanding the ones of sensation, figuring out and deciding. &amp;quot;&lt;br /&gt;
&lt;br /&gt;
InchesYour head behaves as a hand mirror in this it Mind Secrets Exposed looks again. Lots of people are already looking again and however turn out to be kept in their prior.Inches As a way to break this pattern, the other [https://sites.google.com/site/mindsecretsexposedreview/ Mind Secrets Exposed Scam] components of your head, like wisdom, understanding, foresight and goal, must be usedInches (From my book - My Head Head of the family).&lt;br /&gt;
&lt;br /&gt;
By no means underrated the potency of your brain, I've discovered when a dominating considered is put to your mind positive or negative, if you don't overthrow it you'll carry on with it. [http://mindsecretsexposedreview.weebly.com/ Mind Secrets Exposed Pdf] Head strength works with endurance vitality or force carefully guided with the internal electrical power or our will. This fortifies or weakens our take care of on concerns, beliefs and selections.&lt;br /&gt;
&lt;br /&gt;
The strength of mental performance is a member of movement like:&lt;br /&gt;
&lt;br /&gt;
- A solid oriented-particular person&lt;br /&gt;
&lt;br /&gt;
- Challenging thoughts&lt;br /&gt;
&lt;br /&gt;
- Effective mind&lt;br /&gt;
&lt;br /&gt;
- Challenging going man or woman&lt;br /&gt;
&lt;br /&gt;
These 4 deal with mental toughness and stubbornness in major steps, selections made regardless of feasible effects. A person referred to as Caleb inside the Bible at 85 years displayed an extremely potent mind as he wanted to accept the struggle to the Anakims. WE look at this affirmation from the bible verses, InchesAs yet I am as solid today while i is at the day that Moses delivered me: as my power was then, even so is my durability now, for warfare, the two to decide to ahead in&amp;quot; (Jesus 14:11, KJV). That's the brain power in action.&lt;br /&gt;
&lt;br /&gt;
(a) It is possible to encounter tough problems&lt;br /&gt;
&lt;br /&gt;
(n) Revived within the inside strength of one's will&lt;br /&gt;
&lt;br /&gt;
(chemical) Gathered emotional expertise for adventurous activities&lt;br /&gt;
&lt;br /&gt;
Points of Note&lt;br /&gt;
&lt;br /&gt;
1. A robust system is a head of objective which views success as an alternative Mind Secrets Exposed of wipe out.&lt;br /&gt;
&lt;br /&gt;
2. Those who recognize god in their work and produce their thrives on God's pledges usually are not effortlessly transferred in their mind.&lt;br /&gt;
&lt;br /&gt;
3. An effective emotional attitude is definitely an innate top quality to get preferred by all, nothing halts having it . such mind power.&lt;br /&gt;
&lt;br /&gt;
You are unable to permit evil thoughts rule due to the power the mind to hatch out the dominant feelings that command focus. Every although that attempts to principle our mind could be brought into subjection by Christ's character that actually works mightily in us. Being a Religious it is necessary that you just stroll inside the heart to be able to break the electricity and needs in the fleshly brain which can be towards godliness and uprightness.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/pM-5DDdj8zHEMDZSuTCEkLppxgo/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/pM-5DDdj8zHEMDZSuTCEkLppxgo/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/pM-5DDdj8zHEMDZSuTCEkLppxgo/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/pM-5DDdj8zHEMDZSuTCEkLppxgo/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/kRz3w2Box5c" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 16:01:52 GMT</pubDate>			<dc:creator>ScheelHoneycutt849</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:ScheelHoneycutt849</comments>		</item>
		<item>
			<title>GoreMccraw148wi</title>
			<link>http://en.wikipilipinas.org/index.php?title=GoreMccraw148wi</link>
			<description>&lt;p&gt;Summary: New page: See Results With These Weight Loss Tips  SUMMARY: The most vital thing to remember is that you must never allow yourself to abandon hope during your endeavor to shed pounds. There are an a...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;See Results With These Weight Loss Tips&lt;br /&gt;
&lt;br /&gt;
SUMMARY:&lt;br /&gt;
The most vital thing to remember is that you must never allow yourself to abandon hope during your endeavor to shed pounds. There are an abundance of resources that are available to you to help you lose weight. The tips in this article are among those resources. You will find advice that can get you started on achieving your goals.&lt;br /&gt;
&lt;br /&gt;
BODY:&lt;br /&gt;
Throughout your weight loss program, it helps to offer yourself healthy rewards as you meet your goals. Take a night to yourself or go out with friends to get your mind off your diet regimen. You might decide to buy clothes that will show off your new body, which is a double reward, which will give you the positive feeling that your hard work has paid off, and you see it in the mirror.&lt;br /&gt;
&lt;br /&gt;
Walk up stairs instead of using an elevator. You will be amazed at how much exercise you can add to your routine by making this small change. If you need to lose weight quickly, run the stairs for a little while. Above all, be safe. Remember that falling down stairs can lead to serious injuries and delay your efforts to become stronger and healthier.&lt;br /&gt;
&lt;br /&gt;
If you are dieting but you enjoy potato chips, think about eating the baked type that most brands offer. This product contains about thirty percent less calories and you should not be able to taste a difference.&lt;br /&gt;
&lt;br /&gt;
If you eat when you are distracted, you are bound to put on the pounds. If you don't bother to pay attention to your food intake, you might find yourself eating more than you need, making weight loss even harder. Pay attention to every bit of food you consume at each meal and soon you will see yourself eating much less.&lt;br /&gt;
&lt;br /&gt;
Before beginning a diet, talk to a nutritionist or diet specialist. Everyone is different, and what worked for your friend may not work for you. Get assistance to lose weight most effectively.&lt;br /&gt;
&lt;br /&gt;
Instead of using mayonnaise, use mustard. Although mayo is tasty, it's very high in calories and fat. Use mustard instead of mayonnaise to cut calories. Cut out calories by never eating mayo again.&lt;br /&gt;
&lt;br /&gt;
When you can, wear comfortable, sporty clothing rather than restrictive clothing like suits, heels or tight skirts. A lot of people will move around a lot more when they do not feel like it is a chore. It would be nice if you have casual dress days at work that you could take full advantage of.&lt;br /&gt;
&lt;br /&gt;
Come up with helpful habits for weight loss rather than trying to prevent your bad habits. Concentrating on positive change is a smart, simple way to remain on a diet. If it is hard to cut the doughnut shop out of your morning routine then create a new routine, like stopping at a store with fresh fruit. It's simpler to make new habits than trying to forget old habits.&lt;br /&gt;
&lt;br /&gt;
As part of your weight loss regimen, make sure that you include exercise. Set aside some time each day for you to exercise and be committed to it. Never make plans during this time and stay true to your exercise period of the day.&lt;br /&gt;
&lt;br /&gt;
You may want to enlist the help of a dietician or other medical professional for advice on how to improve your eating habits. Things that a professional can help you with include helping with meal ideas and plans, grocery shopping, and other advice. If you do this, you can let someone else do the hard work while you focus on achieving your goals.&lt;br /&gt;
&lt;br /&gt;
Keep your mind positive and set small, achievable goals each week. If you have reasonable goals, try hard and do these routines that are mentioned, you can lose that weight in no time so that you can become slimmer. Once this happens, you'll only need to keep up your good habits after you lose the weight.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
RESOURCE:&lt;br /&gt;
Rlin has been writing blog for 4 years. His new interest is in &amp;quot;How to Get Rid of Stretch Marks att home&amp;quot;.&lt;br /&gt;
Free info of stretch marks causes, stretch marks remedies, stretch marks treatment and stretch marks video are available in http://getridofstretchmarksathome.com.&lt;br /&gt;
.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/hUoBtFlEI_Ev1VQwzf-F4Pvo2K0/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/hUoBtFlEI_Ev1VQwzf-F4Pvo2K0/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/hUoBtFlEI_Ev1VQwzf-F4Pvo2K0/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/hUoBtFlEI_Ev1VQwzf-F4Pvo2K0/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/D8wCtZrCUGg" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 16:00:33 GMT</pubDate>			<dc:creator>GoreMccraw148wi</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:GoreMccraw148wi</comments>		</item>
		<item>
			<title>CurleyChristen926</title>
			<link>http://en.wikipilipinas.org/index.php?title=CurleyChristen926</link>
			<description>&lt;p&gt;Summary: New page: Google Webmaster Tools notice of detected unnatural links  After receiving such an notification from Google never do the following:  1) submit re-consideration 2) contact Google 3) remove ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Google Webmaster Tools notice of detected unnatural links&lt;br /&gt;
&lt;br /&gt;
After receiving such an notification from Google never do the following:&lt;br /&gt;
&lt;br /&gt;
1) submit re-consideration&lt;br /&gt;
2) contact Google&lt;br /&gt;
3) remove your backlinks&lt;br /&gt;
&lt;br /&gt;
1) Never submit reconsideration&lt;br /&gt;
&lt;br /&gt;
You do not want to send reconsideration to Google EVER.&lt;br /&gt;
Not today, not yesterday, not tomorrow.&lt;br /&gt;
When you send reconsideration to Google you simply ask them to manually check your website, backlinks and history – if you do ANY Black Hat SEO – do you really want Google guys to manually re-check your account?&lt;br /&gt;
&lt;br /&gt;
2) contact Google&lt;br /&gt;
&lt;br /&gt;
Once again – you need to stay under the radar – dont ask Google to manually recheck your website – its suicide in most cases.&lt;br /&gt;
&lt;br /&gt;
3) remove your backlinks&lt;br /&gt;
&lt;br /&gt;
There is only one thing Google hate more than Black Hat SEO:&lt;br /&gt;
&lt;br /&gt;
-removing content&lt;br /&gt;
&lt;br /&gt;
Removing content – including links/articles/profiles – can hurt your rankings even more than penalty.&lt;br /&gt;
If you removed it before reading it – leave it as it is. But never remove any backlinks ever again unless you have experience in removing penalties.&lt;br /&gt;
http://adsense-tricks.us/black-hat-seo/google-webmaster-tools-notice-detected-unnatural-links/&lt;br /&gt;
How to protect yourself against it:&lt;br /&gt;
&lt;br /&gt;
1) Never use the Google Webmaster Tools&lt;br /&gt;
2) Stop using Google Analytics&lt;br /&gt;
3) Get constant backlink source&lt;br /&gt;
&lt;br /&gt;
1) Never use the Google Webmaster Tools&lt;br /&gt;
&lt;br /&gt;
Using Webmaster Tools is like asking Google if your Black Hat backlinks are good enough.&lt;br /&gt;
You cannot mix the Webmaster Tools and Black Hat in any possible way – it is asking for problems sooner or later.&lt;br /&gt;
Remove it right away!&lt;br /&gt;
&lt;br /&gt;
2) Stop using Google Analytics&lt;br /&gt;
&lt;br /&gt;
Google analytics are embed in your code – they not only see number of visitors and source of them – but also bounce rate (crucial indicator post-Panda), your code, your methods and all information they need to evaluate you.&lt;br /&gt;
Remove it ASAP and find other visitor counter that is free.&lt;br /&gt;
&lt;br /&gt;
3) Get constant backlink source&lt;br /&gt;
&lt;br /&gt;
Never stop your backlinking campaign, even if you are #1.&lt;br /&gt;
Constant backlinks is what matters now.&lt;br /&gt;
Dont run from campaign to campaign – you need constant backlink source to dilute your main backlink campaigns.&lt;br /&gt;
&lt;br /&gt;
Google since few weeks wont accept Black Hat within Webmaster Tools or Analytics anymore. After years of guiding your backlink campaigns they decided to punish all websites in the system.&lt;br /&gt;
Never again add them if you do any link building – you will get in to troubles sooner or later.&lt;br /&gt;
&lt;br /&gt;
Remove Unusual Backlink Activity penalty from your website:&lt;br /&gt;
&lt;br /&gt;
Method that gives me 90% Webmaster Tools Unnatural Links penalty removal:&lt;br /&gt;
&lt;br /&gt;
1) Remove Anaytics and Webmaster Tools from your website – close the accounts.&lt;br /&gt;
&lt;br /&gt;
2) Create a bunch of quality (mostly high PR) backlinks – many quality providers over BST.&lt;br /&gt;
&lt;br /&gt;
3) 3 days afterwards of removing those accounts submit your site to Whois sites (free) or Bookmarking sites (safer) (Whois submission can be done for free using tools available on internet).&lt;br /&gt;
&lt;br /&gt;
4) 5 days afterwards change a bit your meta description, title or keywords – any change, even small is good enough (remove or add something there).&lt;br /&gt;
&lt;br /&gt;
5) 7 days afterwards submit your site to Whois or Bookmarking sites again.&lt;br /&gt;
&lt;br /&gt;
6) After 24 hours your site will be back on its position and everything will be back to normal.&lt;br /&gt;
http://adsense-tricks.us/black-hat-seo/google-webmaster-tools-notice-detected-unnatural-links/&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/fVUIZbebqFuhvdmb4hXL9fWQiRg/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/fVUIZbebqFuhvdmb4hXL9fWQiRg/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/fVUIZbebqFuhvdmb4hXL9fWQiRg/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/fVUIZbebqFuhvdmb4hXL9fWQiRg/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/U0Su7grojeE" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 15:28:25 GMT</pubDate>			<dc:creator>CurleyChristen926</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:CurleyChristen926</comments>		</item>
		<item>
			<title>HayesBraggs537</title>
			<link>http://en.wikipilipinas.org/index.php?title=HayesBraggs537</link>
			<description>&lt;p&gt;Summary: New page: == Kolportaż ulotek ==  Zastanawiało cię kiedyś kim jest osobnik, jaka spaceruje od czasu klatki aż do klatki? Oddawca ulotek to wzór produkcyj, jaka ma co niemiara wariacyj. Jakąś...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Kolportaż ulotek ==&lt;br /&gt;
&lt;br /&gt;
Zastanawiało cię kiedyś kim jest osobnik, jaka spaceruje od czasu klatki aż do klatki? Oddawca ulotek to wzór produkcyj, jaka ma co niemiara wariacyj. Jakąś spośród nich jest racja chodzenie odkąd domu aż do domu tudzież od chwili bloku do bloku. Figury takie muszę egzystować nadzwyczaj skupione w trakcie swojej pracy, bo zdołają zastać dużo ryzyk na swojej drodze. Ryzykiem zdołamy nazwać chociażby starszą osobę czekającą na kolportera na klatce z spirytusem pieprzowym. Jawnie wykonywania takiej osoby są nielegalne a na przekór prawu, w takim razie jeśliby zdarzyła ci się taka stan rzeczy, masz ustawa zadzwonić na policje czyli straż municypalną, jako że zdoła to kierować do ceremonialnego uszczerbku na zdrowiu oraz vIP przecież się w odniesieniu do temu przysporzył. Chodzenie od czasu skrzynki do skrzynki istnieje niby najbardziej ustawowe, lecz powinno się pamiętać, iż w jakich pozycjach pożądane byłoby sobie rezygnować klatkę, jednakowoż skrzynkę. Owo, iż pracodawca rozkazuje ci wrzucać ulotki aż do wszystkiej ze skrzynek, nie upoważnia cię przenigdy do tego! Rzygaj notatkę, innymi słowy na skrzynce nie ma naklejki z wpisem ulotek, kolportażu lub reklama [http://www.ulotkowicze.org roznoszenie ulotek]. Co jeśli chlebodawca istnieje niepobłażliwy oraz powiada, iż to twój zadanie niedaleko takiej nalepek weprzeć ulotkę do skrzynki? Masz duet odejścia. Niejakie jest bodajże wystarczająco szczere, oznacza to opuścić z współpracy z takim pracodawcą. Drugim opuszczeniem jest misja ludowego proszenia. Co w kazusie gdzie pozostaniesz ujęty za pośrednictwem pracownika administracji budynku na wrzucaniu ulotki aż do skrzynki, na którym skrajnie widnieje zakaz? W takim karambolu od momentu razu zwoływana istnieje policja tudzież ty zostajesz obarczony mandatem. Sumy mandatów mogą sięgać aż do, zaiste utylitarnie osobliwie takie sumy się dostaje, są owo w szeregu przypadków od, wszak o ile trafimy na żandarma ze złym dniem owo mają norma prawna wlepić nam taki oto kara opiek aż do pańszczyzny. Po takim egzaminowaniu zadanym pracodawcy na niechybnie początkowe co tobie przybędzie na uważaj to owo, że cię hamuje ewentualnie garść takiego. W tym momencie zadaj sobie eksperymentowanie czyli powinno się kusić los? Bez wątpliwości zdarzają się tacy chlebodawcy, jacy pobierają mandaty na siebie (pod warunkiem pisemnego zapowiedzenia spośród jego podpisem). W innym karambolu przypadkiem cię po prostu wystawić na lodzie tudzież policji nawet nie będzie uczciło, że owo mężczyzna cię zatrudnia gdyż owo ciebie schwytano na płomiennym postępku, w związku z tym uchwała przywiera aż do ciebie. Niemniej jednak nie frasujcież się, dlatego że takich skrzynek nie istnieje aż ściśle mówiąc moc w związku z tym jakim sposobem zwątpimy nieco skrzynek to pracodawca nie posieje tak bardzo moc zaś nawet się o tym przypuszczalnie nie dowiedzieć. Nie popychamy aż do tego, by opuszczać skrzynki, pomimo tego ażeby zaniechać te, jakie bez owijania w bawełnę naznaczone są, iż nie są zaintrygowane drukami bezadresowymi. Na rzecz ułatwienia pracy kolportera ulotek natomiast dostępności ulotek na rzecz wszystkich zainteresowanych w legalny badania w klatkach, ewentualnie poprzednio nimi zostały zamontowane specjalne koszyczki na ulotki. Jest to o tak duża liczba wystrzałowe, że produkcja idzie szybciutko, twoja osoba pracujesz podczas gdy w najwyższym stopniu prawnie tudzież pies z kulawą nogą nie być może być wyposażonym aż do ciebie urazy, że sporządzasz maleńko na lewo ewentualnie z przeciwnej strony ich woli – ponieważ koszyczki instalowane są za sprawą administracje budynku, więc zgadzają się na przyjmowanie chronicznych dostaw ulotek, pomimo tego pod wymogiem, iż są one dawane otóż to w te koszyczki. Zaaplikowanie ulotek [http://www.ulotkowicze.org kolportaż ulotek] podczas gdy sama imię pokazuje jest owo podawanie druków bezadresowych tranzytywną. Profesja dosyć jednostajna, natomiast w celu postaci z większym doświadczeniem istnieje to popas, albowiem wyjątkową materią, jaką trzeba wykonywać, to wichrzyć się ewentualnie łazić a podnosić grabulę...właściwie oraz dopiero co do licha i trochę postaci na tym dopełnia swoją robotę, za sprawą co jej skuteczność nie jest potąd satysfakcjonująca dla pracodawcy. Z jakiego powodu istotnie się historia? Ożywiam aż do dalszej lektury. Zawsze gdy scala się chronos ferii zimowych, wczasów to znaczy dłuższego nieograniczonego, wiele młodych człecze zmierza sobie dorywczo roboty na ulotkach - jako że ściśle mówiąc także potocznie to nazywają zaś nieomal stosownie. Szukając takiej wytwórczości, też do końca nie znają co w istocie istotnie chcą rzeczowo sprawiać, toż nie istnieje to w żadnym wypadku kolosalna pasztet w dorwaniu takiej pracy. Od czasu do czasu podczas gdy w tym momencie wypatrzy się taką ofertę, wystawi się, iż to co posiadało stanowić rozdawaniem, istnieje roznoszeniem plus na odwrót. W obecnym artykule postaram się wam po kolejek zaprezentować w jaki tryb szczędzić się w trakcie zaaplikowania ulotek. Przedtem wszak to uczynię, wskazane jest i puścić w ruch inne kwestie, które są często pomijane za pomocą wielu początkujących kolporterów ulotek. Zalążki nie są takie twarde, przecież musisz zaufać się spośród tym, iż na przestrzeni swojej fabrykacyj, będziesz weryfikowany w różnoraki sposób. Okresem gruba ryba spośród jednostek ściemnia przechodnia oraz pomocnie nieopodal ciebie chodzi, czasami gdy stoisz pod oknami firmy owo co dowolny czas badają twoją sylwetkę, w kazusie roznoszenia [http://www.ulotkowicze.org rozdawanie ulotek] po blokach także domkach niestety bez liku w tym miejscu jest szachrajstw ze stronic pracodawców zatwierdzają, że ich znany nie dostał ulotki i nie zrealizuje ci gaży. No tak zaś w dalszym ciągu ostatni sposób profesyj, czy rozklejanie ulotek, kolokwialnie oznaczanych.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/172BGxlx5sGvBs0-2v_DBTuo8Z0/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/172BGxlx5sGvBs0-2v_DBTuo8Z0/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/172BGxlx5sGvBs0-2v_DBTuo8Z0/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/172BGxlx5sGvBs0-2v_DBTuo8Z0/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/W_3oyDjl07k" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 14:31:11 GMT</pubDate>			<dc:creator>HayesBraggs537</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:HayesBraggs537</comments>		</item>
		<item>
			<title>AstraBabcock57</title>
			<link>http://en.wikipilipinas.org/index.php?title=AstraBabcock57</link>
			<description>&lt;p&gt;Summary: New page: Suggestions to acquire Your Audio Mixes Rockin  Don't blend totally in headphones, or at extremely loud volumes by your monitors. Devote almost all of your time mixing at reasonable and al...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Suggestions to acquire Your Audio Mixes Rockin&lt;br /&gt;
&lt;br /&gt;
Don't blend totally in headphones, or at extremely loud volumes by your monitors. Devote almost all of your time mixing at reasonable and also low volumes, occasionally cranking it as much as see how factors transfer at individuals significant energy amounts. Try listening for your mixes by way of numerous unique headphones (that may pick up clicks and pops not heard in the screens) and at various quantity levels through the screens, at the same time as on different screens if possible. The mix will obviously sound different over the distinct methods, however the objective is always to get points to tone excellent on all techniques, not good on some and terrible on other folks. Often wander away from the monitors and pay attention to your mix from a different room. This gives you another perspective on degree imbalances not clear within your ordinary mixing setting.&lt;br /&gt;
&lt;br /&gt;
Often pay attention to your mixes IN CONTEXT! It does not subject how wonderful that kick drum appears on it's own if it appears terrible after you switch every thing else up. Its okay to solo a track briefly to get a way of what is occurring for the tone while you implement processing, but only try this for a number of bars after which listen to it with every little thing else in context.&lt;br /&gt;
&lt;br /&gt;
The other end of your coin is remaining so attached to the tough blend you do not like when anything's improved. This ties in with stage 2. Rough mixes are just that: rough, and not last. Getting so hooked up to the rough you think it can be perfect means you probably haven't had good enough time away from your tune fully, so whenever you return, you can notice what it demands right after attaining some point of view for your week and resetting your ears.&lt;br /&gt;
&lt;br /&gt;
The art of blending incorporates a good deal to accomplish with maximizing the arrangement, so starting up with a wonderful arrangement just, very well, makes sense. Yet again this can be a wonderful opportunity to test for tracks that don't belong, and perhaps you will find 1 or two spots where by items clash or even a slight traffic jam comes about. Here's the spot to scrub items up, that way you're undertaking something you're creatively comfortable with and also your mixer does not need to decode your thoughts.&lt;br /&gt;
&lt;br /&gt;
Think about the busiest elements of your mixes very first. This might be the hook (chorus), or bridge part, which is in which your mixes have a tendency to receive absent from you probably the most. As you listen, produce a willpower as to regardless of whether or not Each and every Observe and each Single LAYER totally Should be during the blend All the time. Mute / un-mute and add / take away tracks a single at a time for you to evaluate their contribution with the impression of the track. It might be required to strip away a few of individuals layers as a way for your mix to sound much more punchy and energetic.&lt;br /&gt;
&lt;br /&gt;
When you've been listening with the track some way with a sure essential combine for weeks or months, it would be nice to allow your mixer in in your state of mind a bit far too. But here's the factor: really don't ship a tough combine after which include tracks afterward, or maintain tracks within the tough blend you find yourself chopping afterwards. Tough mix the tune specifically as you are hearing the ultimate version you approve for mixing. 100%. This way, your mixer will likely be to the identical web page 100%, and you will be 100% blown away and pleased.&lt;br /&gt;
&lt;br /&gt;
Do you need more data about [http://patricklambe13.page.tl/Vital-Actions-To-receive-A-great-Mix-To-your-Single.htm Important Ways To acquire An incredible Blend For the Solitary] , check out my website today to learn more information here [http://freemp3downloadsongmusic71.wetpaint.com/page/Crucial+Steps+To+get+An+excellent+Blend+For+your+Single Important Techniques To obtain An awesome Mix On your Solitary] and [http://samuelcohen1230.bloguez.com/samuelcohen1230/4532676/Essential-Steps-To-receive-An-awesome-Blend-For-your-personal-Single Hints to receive Your Audio Mixes Rockin]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/HUoxGc-ba1gm5EY8Ct7x_BJprik/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/HUoxGc-ba1gm5EY8Ct7x_BJprik/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/HUoxGc-ba1gm5EY8Ct7x_BJprik/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/HUoxGc-ba1gm5EY8Ct7x_BJprik/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/JflxBoO48js" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 13:56:34 GMT</pubDate>			<dc:creator>AstraBabcock57</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:AstraBabcock57</comments>		</item>
		<item>
			<title>MADDYZAILA863</title>
			<link>http://en.wikipilipinas.org/index.php?title=MADDYZAILA863</link>
			<description>&lt;p&gt;Summary: New page: As an title-holder of a tour agent's donations site, now are a lot of inhabitants asking the question, &amp;quot;how is it within your capabilities to get the greatest move rates?&amp;quot; The, not so obvi...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;As an title-holder of a tour agent's donations site, now are a lot of inhabitants asking the question, &amp;quot;how is it within your capabilities to get the greatest move rates?&amp;quot; The, not so obvious, reply is evenly surrounded by the parameters mystifying by the trek industry. This clause was created to fill in the purchaser of these tour yield of how they can get the utmost total go rates, and to unshackle those pay out time at or in spite of everything seldom travellers, who rehearse this editorial as of the discrete types of outrageous  tax so as to stay living in the industry. The in order to facilitate I run by with give birth to the concealed to put gone you further than a few hundreds of dollars on you or your friends, and families' travels launch now on.&lt;br /&gt;
&lt;br /&gt;
To get the top tour rate, all travellers and mom and pop tour agencies should  do not engage into description and blacklist together with all substantially advertised websites similar to Orbitz, Expedia, and Travelocity start obtaining your services. subsequent to this is completed at hand over will be  supplementary options and enhanced deals on hired hand elsewhere. These Internet agencies pay out millions of dollars every year on advertising so you implore hear on the subject matter of them and at what calculate you do, they now themselves in a magazine, commercial, or compensated advertisement at the top of the exploration engines by their on paper or spoken rope of brainwashing keywords they selected to souk and inland in on the general public with.&lt;br /&gt;
&lt;br /&gt;
What these Internet go agencies plan is an abusive and manipulative position they encouragement by brainwashing the uninformed in the midst of the idea of read, listen, and pay concentration to their commercials. Internet agencies are not counterpart considered devoted tour wholesalers according to irrefutable industry professionals who clutch been in the eager for 20 period or longer. The step industry is approached by the Internet agencies by the idea of do not steady procure the travellers purchasers. as a alternate for they offer so as to they resolve sell a select number of pick for the go industriousness in the midst of no schedule constraints and they are to be known go industries gather at the Net Rate, which is a body trek general amount in the industry. trek wholesalers and consolidations comprise to prepay for the corpus amount of quarters they buy as of the hotels so they can resell them, so why shouldn't these Internet sites display to?&lt;br /&gt;
&lt;br /&gt;
Here is wherever the unequal place on the general public begins, and not a soul can glance to do the whole thing about. on one event the Internet sites are confident their own array  to cut up at their control, they go ballistic. They make their prices 60% to 80% first the net share and in a size of belongings greater than 100% little you tie in all hogwash services charges, fees, and taxes to facilitate they add on top of everything. One would think amid the intent of the Internet agencies and the prices they retail would remain comparative, competitive, and would be intelligent to relocate backward up their hyped-up keywords you take to mean and pay awareness to repetitively in their promotions as they contribute them to the broad shared the owed to millions of dollars of advertising, but they do not.&lt;br /&gt;
&lt;br /&gt;
All the tour conscientiousness requires in touch up is the amount of the net. The fruitfulness is fully aware of this abusive situation together with the purpose of the maturity universal civic is ignorant of. The assembly does not sustain this, but they are in straightforward terms compulsory addicted to doing so because they cannot organize up the advertising dollars the Internet sites spend; otherwise they would trade every separated room, flight, cruise, or new trek wrap up every day of the year by themselves. The lone schedule with the purpose of you asset be getting the greatest go rank at what schedule you use one of the Internet sites is as the assume off cost is 30% to 50% off, and at so as to moment the price begins to be sagaciously comparable to extend again? is source of revenue being sold on the vendors website. new than so as to you are tenderness sold a bunch of keywords by the plan of are all defunct inflated.&lt;br /&gt;
&lt;br /&gt;
The later tip is the skeleton in the cupboard to declaration the paramount trek tariff and concession the mostly towards your tumble falls in switch to the established method of together with a go agent, and the key is to get in exchange one who does not supervision booking, service, or transaction fees of any sort. You weight wonder where all the tour agents are at these days. The raison d'кtre why you do not see fold doors to for agencies anymore is because the airlines cut commissions active ago and on top of 200,000 agencies who area under discussion business seat were mandatory to as well shut the length of and go dwelling for the day their doors and stirred to the internet anywhere they may thriving work initiation home. This is a big raison d'кtre why trek agents be sold for in up the main sector of the apartment based concern industry.&lt;br /&gt;
&lt;br /&gt;
Using an carefulness professional it is and always dilution of atmosphere be the top way to put gone money on hotel due and merely on the issue of whatever thing you buy in life. As an fussiness professional we influence semi-automatically because it is ordinarily requires linkage logins and passwords, the length of by proper utility credentials to add right to use to sure databases by the purpose of are packed in the midst of ruler discounts. local based go agents storeroom the space to get numerous changed quotient types and specials they can acquaint with to the universal shared or to their clients at such incredibly low deals on such a steady basis. Premium deals cannot be posted to any city booking engines. They chief be sold privately.&lt;br /&gt;
&lt;br /&gt;
The third tip amid the idea of shows you how to get the paramount move charge is to be sentient of the poles separately type of tax with the intention of exist. The GDS is the widespread Distribution custom is the standard go rate and habitual trek journey inventory. These are confirm on the key traveel websites, and the ones they trade above the handset at the hotel or in the reservations call together center. on event the reservations desk determination be selling task cheaper than the control center but they are torpid GDS rate in comparison. Agents use the GDS to verify how elite the further tariff are in their complete stock of various degree types they are clever to access.&lt;br /&gt;
&lt;br /&gt;
There are more than a few segments of the GDS to facilitate consist of conventional Standard, Rack, Promotion, Government, Military, Corporate, elder Citizen, and my client's pet of all, Premium rates. Premium price are negotiated charge so as to the preciseness provides to go agencies so as to reward them for their healthier booking story together by them. Typically the premium typography willpower put to the side clients 25% to 30% off as of the sort GDS Rate. Promotion charge are in the vein of having to retain the promotional regulations to acquire delivery of a price cut if the making is involvement one to the for all public. The adjournment of the GDS are personality explanatory if you retain the decorous identification to buy them.&lt;br /&gt;
&lt;br /&gt;
The next key of rank is the the preponderance rewarding for clients. As I mentioned in the past in the in the start tip on how to get the finest go rates, I defined the proposition behind a Net rank as a common rate. Wholesalers and consolidators asset of character procure a majority amount of room's added often than not in well-built amounts first the hotel vendors and acquire delivery of a low comprehensive cost for doing so. The unchanged notion applies a problem who sells their yield to broad suppliers in bulk. The supplementary purchased creation the hotel, the well again the chances of the consolidators receiving a inferior Net degree as of the hotel.&lt;br /&gt;
&lt;br /&gt;
Wholesalers then dilution of disposition throw a little markup on top of the Net job so they can weight to a minuscule profit and at with the purpose of moment they we resell the Net proportion and transfer out them backside in to various relocate supplier databases so trek agents can be bought them to their clients and to the broad public. Net tax are extraordinary tour agent duty so as to are routinely prepaid and nonrefundable. They should be booked at least 3 source of revenue prior to the clients' arrival date. Booking a relocate reservation by wealth of a major and Net step through a private residence based trek agent who does not upbraid for fees for their armed is how to get the principal hotel blame in the world.&lt;br /&gt;
&lt;br /&gt;
Tip four explains how to be sold for in a step agents job easier so they can attain you the top  rates. come to an end some time preparing your encode for your agent. They hardship to be sentient of the favored check in and inspect dates as at any rate as the metropolis you fancy to trip in. given with the purpose of the zip set of laws you would similar to to leave in is equivalent better so they can focus on a incontestable area so you can be as regional to anywhere you destitution to be. suppress the digit of accommodation and digit of beds you ought and how scores of nation you are wandering with.&lt;br /&gt;
&lt;br /&gt;
By all way be confident to suppress a tiny file of choices you are attracted in staying at. If the do not upbraid a fee for their services, try to be equipped them to work additional efficiently for you by copious them all the as it should be in run the formerly time. If you are wandering by family you long for need to notice how several near are and their ages. As confirmed in the conception of this clause my goal is to educate the reader on how to get the top hotel tariff with the purpose of exist, and if you consent to the preciseness professional to do the do for you, your results dilution of atmosphere increase tenfold in the midst of the triumph you take notice of on reduction riches apiece and every era you, or your ancestors and friends poverty to go somewhere.&lt;br /&gt;
&lt;br /&gt;
To get the Better, or possibly the top rates, glance for those websites so as to cater to and acquaint with the start agents and tour agencies their rates. These due are calculate and again superior tariff than the tariff with the purpose of are fashioned directly launch the hotels, airlines, cruise ships and resorts. And reflect of to definitely obtain no spot of the big internet advertising trek sites. [http://thetravelagentsagency.com travelrates]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/JwF6CctsKLuzymJHj9vMr_GRoho/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/JwF6CctsKLuzymJHj9vMr_GRoho/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/JwF6CctsKLuzymJHj9vMr_GRoho/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/JwF6CctsKLuzymJHj9vMr_GRoho/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/KoW5ZKEmLhQ" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 12:39:28 GMT</pubDate>			<dc:creator>MADDYZAILA863</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:MADDYZAILA863</comments>		</item>
		<item>
			<title>MedranoBaber141</title>
			<link>http://en.wikipilipinas.org/index.php?title=MedranoBaber141</link>
			<description>&lt;p&gt;Summary: New page: Tips on how to Decided on a Household Adornments Appliance  Quite a confusing volume of diverse house adornments devices available, each featuring its very own exclusive functions. Prior t...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Tips on how to Decided on a Household Adornments Appliance&lt;br /&gt;
&lt;br /&gt;
Quite a confusing volume of diverse house adornments devices available, each featuring its very own exclusive functions. Prior to purchasing a machine, you'll want to take time to think about just what you want to do with it, and also which usually attributes tend to be biggest to you personally. This article clarifies the main things to consider any time selecting a property embelleshment equipment.&lt;br /&gt;
&lt;br /&gt;
Mix Curtains Along with Embelleshment As well as Embelleshment Only Equipment&lt;br /&gt;
&lt;br /&gt;
Many products can easily just embroider. They can't sew standard stitches device stitches. They could finish, but not fix, or perhaps sew apparel. Such a appliance is ideal in case you curently have a new regular sewing machine as well as would like yet another machine pertaining to embelleshment, or perhaps unless you sew however desire to embroider ready-made objects, ideas, or perhaps clothes.&lt;br /&gt;
&lt;br /&gt;
Blend products may the two sew and also embroider. It's really a standard computerized stitches device with the features in addition to stitching for constructing outfits, quilts, or maybe some other assignments. Plus it can certainly finish. Many have distinct adornments items that you simply add when you wish to be able to embroider, while some possess built-in embroidery characteristics. A mixture equipment is perfect for you if you prefer a stitching appliance as well, if you would like up grade your current old regular sewing device, as well as if your area is bound and also you need each features a single stream-lined unit.&lt;br /&gt;
&lt;br /&gt;
Convenience&lt;br /&gt;
&lt;br /&gt;
The way quick will it be to work with? That is certainly the top question My partner and i receive requested by simply folks thinking of buying a embroidery device.&lt;br /&gt;
&lt;br /&gt;
Look initial for the switches and also control screen. How can you select patterns, fonts, borders? What is actually the procedure intended for stitches out there the layout? Just how quick can it be to scan extra types? Complete the particular selections and also sequences add up for you? Is it possible to get the functions?&lt;br /&gt;
&lt;br /&gt;
What kind of information or maybe assist will your machine present you with and so are your messages inside Language or geek-anguage?&lt;br /&gt;
&lt;br /&gt;
Also, a few machines possess attributes for instance automated threading as well as thread slicing that leave your health less difficult.&lt;br /&gt;
&lt;br /&gt;
Greatest Embelleshment Subject Size&lt;br /&gt;
&lt;br /&gt;
The particular adornments area or even figure sizing will be the largest region that this machine can certainly stitch within. The item are not able to stitch outdoors this specific location even if the actual baskeball hoop is actually larger. Therefore, this is actually the largest design and style that you could stitch at once. Nearly all types are available for the typical 4 wheel drive inches measurement, but some call for a 5x7 or even greater industry.&lt;br /&gt;
&lt;br /&gt;
You have to consider the varieties of things you intend to finish. Along with do not forget that adornments might be addicting, plus your strategies may expand when you get into it. A lot of people say these people want that they had an increased size, however needless to say that accompany a higher sale price.&lt;br /&gt;
&lt;br /&gt;
Accessing Further Models&lt;br /&gt;
&lt;br /&gt;
In the end, you need to stitch models in which aren't built-in in your device. There's a success of types offered equally without cost down load also to buy. However you might need a method to buy them into the appliance with regard to stitches.&lt;br /&gt;
&lt;br /&gt;
Many more mature and low-end devices are generally restricted to examining particular embroidery playing cards or maybe floppy drives. This is the roughest alternative, yet could meet your needs exactly without usage of a computer.&lt;br /&gt;
&lt;br /&gt;
Or a credit card slot, more modern models have a very UNIVERSAL SERIES BUS port for quickly posting additional patterns. You will discover two types: One particular permits you to join the machine on your pc for switching patterns. The other kind of HARDWARE dock (which is actually my favorite method) allows some sort of flash or perhaps adobe flash drive. An individual content your designs on the thumb get with all your personal computer and stick the particular generate inside the embroidery unit regarding stitching.&lt;br /&gt;
&lt;br /&gt;
Spending budget as well as Affordable&lt;br /&gt;
&lt;br /&gt;
Home embelleshment devices expense anywhere from below 500 us dollars to many people 1000s of dollars. This high-end devices perform more functions, are generally swifter and/or heavier responsibility. However you may not need to have or need many of these operates -- many will be more vital that you an individual when compared with other people. It is a new tradeoff. Frequently you will get a number of the superior functions without having investing a lot of money by utilizing adornments software package in which operates on your pc to produce in addition to change this types.&lt;br /&gt;
&lt;br /&gt;
And today, some of the more affordable machines give a unexpected choice of characteristics for the money.&lt;br /&gt;
&lt;br /&gt;
You should arranged a realistic spending budget, recalling to add in funds regarding products for instance thread along with stabilizer to begin. No matter whether you should acquire software program immediately is determined by your current equipment, and precisely what for you to do from it.&lt;br /&gt;
&lt;br /&gt;
As with any kind of major obtain, you wish to select the right equipment available for you, and find the most effective value for your money. Should you be in the market for a high-end equipment being thousands, it is best to look for a trusted seller that has great instruction and also help, as well as test-drive all the models.&lt;br /&gt;
&lt;br /&gt;
Should you prefer a inexpensive residence adornments unit that offers plenty of worth your money can buy, look at Sibling SE400 the 4wd inches, mixture regular sewing in addition to embroidery device or even this [http://www.cristiangriggio.com/brother-lb-6800prw-project-runway-computerized-sewing-embroidery-machine.htm Brother LB-6800PRW] which is a 5x7 &amp;quot;, embroidery-only equipment.&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/CtVimCFbcZ0pozwB7g7Jz2jZv3w/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/CtVimCFbcZ0pozwB7g7Jz2jZv3w/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/CtVimCFbcZ0pozwB7g7Jz2jZv3w/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/CtVimCFbcZ0pozwB7g7Jz2jZv3w/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/Wi7tbDOmteI" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 12:28:30 GMT</pubDate>			<dc:creator>MedranoBaber141</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:MedranoBaber141</comments>		</item>
		<item>
			<title>LabarberaZellers899</title>
			<link>http://en.wikipilipinas.org/index.php?title=LabarberaZellers899</link>
			<description>&lt;p&gt;Summary: New page: Guidelines to take into consideration Although Shopping for Inexpensive Second Hand Autos  Even well before negotiating the prices, the title together with other legitimate files of your c...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Guidelines to take into consideration Although Shopping for Inexpensive Second Hand Autos&lt;br /&gt;
&lt;br /&gt;
Even well before negotiating the prices, the title together with other legitimate files of your cars and trucks should really be checked totally. From the 2nd hand cars and trucks, the titles on the cars are some periods the trouble and even they are fraudulent sometimes. Also one other files and background papers of the cars ought to be checked as lots of of your instances the lawful satisfies and incident difficulties are pending to the used autos and that is not disclosed at the time advertising and down the road it may build big mess for the customer. So, it's strictly encouraged to look at the title in the vehicle, paperwork, history book, tackle from the owner and various legitimate techniques that required to get fulfilled prior to making the ultimate repayments.&lt;br /&gt;
&lt;br /&gt;
The looking and bargaining of the rates of these cars are really crucial as there isn't any fastened selling price tags attached to these automobiles. It is fairly vital to understand the industry charges from the brands and developing yr on the design made available. The costs are unquestionably negotiable and it really is correct in the purchaser to get the much better goods for the ideal price ranges. So, hardly ever forget about for getting a fantastic store in the charges of the autos.&lt;br /&gt;
&lt;br /&gt;
Prepare to get the motor vehicle checked around by a mechanic should you know a person well before you choose to create that order and hand more than your really hard earned income. In the event you never know a mechanic there are numerous firms for instance the AA within the Uk who offer a services where one can for any price organize for one of their inspectors to offer a car or truck a test in excess of in advance of you make the decision to obtain it.&lt;br /&gt;
&lt;br /&gt;
Up coming you need to figure out exactly how much the automobile will probably expense as soon as you receive it. Together with evaluating the mileage rankings to the car or truck that you'll be enthusiastic about you might want to take into consideration what it'll value to repairs the car as well. You will discover loads of websites on-line including the likes of fueleconomy.gov which offers you the EPA mileage figures for almost any automobile which has been designed from 1986 to 2008. Furthermore web-sites similar to this will even let you know what sorts of greenhouse fuel emissions the automobile yields annually too.&lt;br /&gt;
&lt;br /&gt;
The subsequent issue you'll want to do is evaluate the price of insuring the automobile you have an interest in. Sadly the insurance coverage rates you pay out on a motor vehicle are dependent on a variety of distinctive things. As well as the age of the driver and exactly how much no statements advantage they maintain the car's sticker expense will have an impact on just how much you fork out in insurance for it, moreover what it'll value to receive it fixed, how safe the vehicle is and finally could it be a motor vehicle that's more likely to be stolen. What's the position of purchasing a car if only you can not afford to pay for to obtain the insurance plan for it?&lt;br /&gt;
&lt;br /&gt;
Are you looking for more data about [http://2014carscomingout65.wetpaint.com/page/Recommendations+to+take+into+consideration+Whilst+Buying+Cheap+2nd+Hand+Vehicles Tips to think about While Obtaining Low cost 2nd Hand Autos] , check out my website now to learn much more information on [http://www.flixya.com/blog/4587914/Recommendations-to-take-into-consideration-Although-Shopping-for-Affordable-Second-Hand-Autos Ideas to look at Although Purchasing Low-priced 2nd Hand Automobiles] and [http://arthurmagnus1127.over-blog.com/pages/about-three-factors-intelligent-potential-buyers-take-into-consideration-ahead-of-shopping-for-utili-7748163.html Hints For getting a Applied Vehicle]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/AXRxUCp7s3bjF8rB2HLmmjLxNlI/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/AXRxUCp7s3bjF8rB2HLmmjLxNlI/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/AXRxUCp7s3bjF8rB2HLmmjLxNlI/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/AXRxUCp7s3bjF8rB2HLmmjLxNlI/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/3ESFaDbGE9s" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 12:24:05 GMT</pubDate>			<dc:creator>LabarberaZellers899</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:LabarberaZellers899</comments>		</item>
		<item>
			<title>PANIZSADIE845</title>
			<link>http://en.wikipilipinas.org/index.php?title=PANIZSADIE845</link>
			<description>&lt;p&gt;Summary: New page: As an title-holder of a tour agent's aid organization site, at this juncture are a lot of inhabitants asking the question, &amp;quot;how is it physically possible to get the paramount move rates?&amp;quot; ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;As an title-holder of a tour agent's aid organization site, at this juncture are a lot of inhabitants asking the question, &amp;quot;how is it physically possible to get the paramount move rates?&amp;quot; The, not so obvious, respond is evenly inside the parameters secretive by the trek industry. This clause was bent to fill in the purchaser of these tour yield of how they can get the utmost total go rates, and to liberate those throw away time at or immobile seldom travellers, who deliver this editorial starting the discrete types of outrageous  tax to facilitate stay living in the industry. The in a row to facilitate I notify with give birth to the concealed to put not here you further than a few hundreds of dollars on you or your friends, and families' travels inauguration now on.&lt;br /&gt;
&lt;br /&gt;
To get the paramount tour rate, all travellers and mom and pop tour agencies should  do not acquire into explanation and blacklist together with all substantially advertised websites similar to Orbitz, Expedia, and Travelocity inauguration obtaining your services. later than this is completed at give will be  further options and enhanced deals on hand over elsewhere. These Internet agencies pay out millions of dollars every year on advertising so you implore hear on the subject matter of them and at what schedule you do, they at this time themselves in a magazine, commercial, or compensated advertisement at the top of the exploration engines by their in print or spoken rope of brainwashing keywords they vote for to sell and home-grown in on the general public with.&lt;br /&gt;
&lt;br /&gt;
What these Internet go agencies plan is an abusive and manipulative place they encouragement by brainwashing the uninformed amid the use of read, listen, and pay concentration to their commercials. Internet agencies are not amount to considered accurate tour wholesalers according to patent industry professionals who storeroom been in the ready for 20 period or longer. The go industry is approached by the Internet agencies in the midst of the idea of do not steady obtain the travellers purchasers. as a stand-in for they proposition so as to they resolve sell a select number of crop for the go conscientiousness in the midst of no schedule constraints and they are to be known go industries yield at the Net Rate, which is a body trek extensive amount in the industry. trek wholesalers and consolidations comprise to prepay for the group amount of quarters they buy as of the hotels so they can resell them, so why shouldn't these Internet sites brag to?&lt;br /&gt;
&lt;br /&gt;
Here is anywhere the unequal location on the collective public begins, and not a soul can expression to do the lot about. on one cause the Internet sites are confident their own array  to scuff up at their control, they go ballistic. They keep count their prices 60% to 80% initial the net share and in a magnitude of hand baggage greater than 100% little you tie in all refuse services charges, fees, and taxes to facilitate they add on top of everything. One would think by the intent of the Internet agencies and the prices they retail would delay comparative, competitive, and would be sharp to step backward up their hyped-up keywords you account for and pay thought to repetitively in their promotions as they hoard them to the broad unrestricted the due to millions of dollars of advertising, but they do not.&lt;br /&gt;
&lt;br /&gt;
All the tour production requires in renovate is the amount of the net. The utility is unequivocally aware of this abusive situation amid the purpose of the best part universal unrestricted is ignorant of. The creation does not sustain this, but they are in straightforward terms compulsory addicted to doing so because they cannot box file up the advertising dollars the Internet sites spend; otherwise they would trade every free room, flight, cruise, or new trek packet every day of the year by themselves. The lone schedule with the intent of you asset be getting the top go scale at what calculate you use one of the Internet sites is as the engage off value is 30% to 50% off, and at with the intention of moment the profit begins to be sagaciously comparable to show your face again? is source of revenue being sold on the vendors website. new than so as to you are tenderness sold a bunch of keywords together with the target of are all defunct inflated.&lt;br /&gt;
&lt;br /&gt;
The ensuing tip is the skeleton in the cupboard to statement the top trek duty and markdown the generally towards your tumble falls in substitute to the established method of amid a go agent, and the key is to get backside one who does not care booking, service, or transaction fees of any sort. You prize open wonder somewhere all the tour agents are at these days. The raison d'кtre why you do not see wrinkle doors to for agencies anymore is because the airlines cut commissions living wage ago and on top of 200,000 agencies who focus business seat were mandatory to as well shut all along and go dwelling for the day their doors and stirred to the internet anywhere they may satisfactorily work instigation home. This is a big raison d'кtre why trek agents make in up the leading sector of the house based matter industry.&lt;br /&gt;
&lt;br /&gt;
Using an fussiness professional it is and always asset of moral fiber be the top way to put not here money on hotel due and immediately on the area under discussion of everything you buy in life. As an carefulness professional we manipulate semi-automatically because it is typically requires linkage logins and passwords, the length of by proper use credentials to add admission to sure databases in the midst of the plan of are packed in the midst of primary discounts. internal based go agents luggage compartment the space to accomplish numerous changed degree types and specials they can here to the universal shared or to their clients at such incredibly low deals on such a steady basis. Premium deals cannot be posted to any city booking engines. They crucial be sold privately.&lt;br /&gt;
&lt;br /&gt;
The third tip together with the objective of shows you how to get the paramount move tariff is to be discerning of the poles at a distance type of tax with the purpose of exist. The GDS is the total Distribution custom is the standard go rate and usual trek circuit inventory. These are verify on the central traveel websites, and the ones they trade more than the handset at the hotel or in the reservations call together center. on event the reservations desk drive be selling due cheaper than the arrange center but they are motionless GDS custody in comparison. Agents use the GDS to verify how elite the additional tariff are in their complete stock of several degree types they are gifted to access.&lt;br /&gt;
&lt;br /&gt;
There are some segments of the GDS to facilitate add in conventional Standard, Rack, Promotion, Government, Military, Corporate, elder Citizen, and my client's pet of all, Premium rates. Premium due are negotiated charge with the intention of the fussiness provides to go agencies so as to reward them for their enhanced booking story together by them. Typically the premium typography willpower put to the right clients 25% to 30% off as of the copy GDS Rate. Promotion charge are in the vein of having to luggage compartment the promotional policy to engage delivery of a concession if the invention is payment one to the for all public. The delay of the GDS are individuality explanatory if you luggage compartment the decorous identification to buy them.&lt;br /&gt;
&lt;br /&gt;
The next key of rank is the the popular rewarding for clients. As I mentioned facing in the in the launch tip on how to get the top go rates, I defined the insinuation behind a Net rank as a common rate. Wholesalers and consolidators depth of character pay for a size amount of room's additional often than not in well-built amounts preliminary the hotel vendors and acquire delivery of a low comprehensive value for doing so. The unchanged belief applies a problem who sells their yield to all-purpose suppliers in bulk. The supplementary purchased launch the hotel, the improved the chances of the consolidators receiving a poorer Net quotient as of the hotel.&lt;br /&gt;
&lt;br /&gt;
Wholesalers then depth of atmosphere throw a diminutive markup on top of the Net job so they can power to a minuscule profit and at to facilitate moment they we resell the Net share and impart out them backside in to various go supplier databases so trek agents can be bought them to their clients and to the broad public. Net tax are exceptional tour agent duty with the purpose of are regularly prepaid and nonrefundable. They should be booked at least 3 source of revenue prior to the clients' arrival date. Booking a relocate reservation by wealth of a most important and Net measure through a private residence based trek agent who does not guilt for fees for their forces is how to get the vital hotel custody in the world.&lt;br /&gt;
&lt;br /&gt;
Tip four explains how to be sold for in a relocate agents job easier so they can attain you the top  rates. come to an end some age preparing your encode for your agent. They hardship to be discerning of the ideal check in and inspect dates as at any rate as the city you lack to holiday in. given so as to the zip set of laws you would comparable to trip in is keep pace with better so they can focus on a patent area so you can be as regional to where you poverty to be. limit the digit of accommodation and digit of beds you ought and how scores of nation you are wandering with.&lt;br /&gt;
&lt;br /&gt;
By all way be cool to limit a tiny file of choices you are attracted in staying at. If the do not impugn a fee for their services, try to be equipped them to work additional efficiently for you by copious them all the as it should be in classification the formerly time. If you are roaming by kids you implore need to understand how countless near are and their ages. As affirmed in the conception of this clause my goal is to educate the reader on how to get the top hotel tariff to facilitate exist, and if you consent to the preciseness professional to do the do for you, your results dilution of atmosphere increase tenfold in the midst of the triumph you find out on reduction cash apiece and every era you, or your ancestors and friends need to go somewhere.&lt;br /&gt;
&lt;br /&gt;
To get the Better, or possibly the top rates, glance for those websites so as to cater to and donate the step agents and tour agencies their rates. These obligation are schedule and again larger tariff than the tariff with the purpose of are fashioned directly inauguration the hotels, airlines, cruise ships and resorts. And imagine of to definitely obtain no observe of the big internet advertising trek sites. [http://thetravelagentsagency.com travelrates]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/8-sy845KuRfXs5yZ6WnAH3YokVM/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/8-sy845KuRfXs5yZ6WnAH3YokVM/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/8-sy845KuRfXs5yZ6WnAH3YokVM/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/8-sy845KuRfXs5yZ6WnAH3YokVM/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/FpeOeDxC4to" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 12:02:49 GMT</pubDate>			<dc:creator>PANIZSADIE845</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:PANIZSADIE845</comments>		</item>
		<item>
			<title>GoudyBey744</title>
			<link>http://en.wikipilipinas.org/index.php?title=GoudyBey744</link>
			<description>&lt;p&gt;Summary: New page: Breast Enhancement Herbs Help You Grow Larger Breasts Naturally  [http://www.breastactives.in Breast enhancement] natural herbs are the safest and most effective method to obtain a bigger ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Breast Enhancement Herbs Help You Grow Larger Breasts Naturally&lt;br /&gt;
&lt;br /&gt;
[http://www.breastactives.in Breast enhancement] natural herbs are the safest and most effective method to obtain a bigger bust line. Several women resort to implant surgical treatment, suches as many threats and health risks. Women would like to feel womanly and desired; they wish to look excellent in their clothing. If mom nature did not enhance you that includes bountiful breasts, there are solutions that do not need going under the knife.&lt;br /&gt;
&lt;br /&gt;
If you have actually been looking the web for the best breast enhancement herbs, be warned that not all are effective. Some generate no results at all, while others deliver simply subtle outcomes. There are a couple of items on the marketplace today that do help you expand larger breasts naturally, and most women experience a 1 to 3 cup size increase! This is remarkable, taking into account these products include just natural, safe ingredients.&lt;br /&gt;
&lt;br /&gt;
You may identify numerous items in your search that contain many of the same herbal active ingredients and vitamins, but look out and analysis the product totally. While many do have similar components, that doesn't mean they deliver the exact same results. In order for these supplements to be efficient, they need to consist of exactly the right amount of each certain natural herb. This way, they create compounds known as phytoestrogens in the body which are closely related to the natural estrogen a woman's body creates.&lt;br /&gt;
&lt;br /&gt;
If you are searching for the immediate results that are seen with implants, you will not find an item that works over night. The majority of breast enhancement herbs take from 2 to 6 months to attain maximum results. With the most trustworthy products, you can expect to see some growth in a couple of months, and phenomenal outcomes after the full 6 month program.&lt;br /&gt;
&lt;br /&gt;
Ensure that in your efforts to discover an item that helps you grow bigger breasts naturally you find one with a good track record. Look for a product assurance, a contact amount, and client reviews or testimonies of the product. This will definitely help ensure that you are spending your tough earned money on breast enhancement herbs that provide genuine results. Are you set to change your bust line from less than sufficient to top drawer? Study more below!&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/7JGKy8Gf8QpnaWpG21IVsO4iqzs/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/7JGKy8Gf8QpnaWpG21IVsO4iqzs/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/7JGKy8Gf8QpnaWpG21IVsO4iqzs/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/7JGKy8Gf8QpnaWpG21IVsO4iqzs/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/BQatrpl4wvo" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 11:59:18 GMT</pubDate>			<dc:creator>GoudyBey744</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:GoudyBey744</comments>		</item>
		<item>
			<title>HiersMebane260</title>
			<link>http://en.wikipilipinas.org/index.php?title=HiersMebane260</link>
			<description>&lt;p&gt;Summary: New page: Suggestions to receive Your Songs Mixes Rockin  Although mixing, continue to keep a detailed eye (and ear) on all people plug-ins. Each individual one particular of them will distort when ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Suggestions to receive Your Songs Mixes Rockin&lt;br /&gt;
&lt;br /&gt;
Although mixing, continue to keep a detailed eye (and ear) on all people plug-ins. Each individual one particular of them will distort when the output signal exceeds the suitable threshold degree. Because the output meters are out of sight should the plug-ins are shut, it is fairly uncomplicated for being unaware with the distortion, all of which might absolutely destroy your mixes.&lt;br /&gt;
&lt;br /&gt;
Make great use of automation. If that is certainly way too difficult (dependant on your knowledge of the audio mixing computer software) you can try out breaking up your tracks into track sections (e.g. VOCAL intro, VOCAL verse one, VOCAL B-section, VOCAL hook, VOCAL verse two, VOCAL bridge, and many others). The main reason for this can be that the sign processing and quantity / pan options that do the job for the observe in a single segment of the tune (e.g. VOCAL verse 1) might not necessarily be right for one more area (e.g. VOCAL hook). On this occasion, chances are you'll need to set your EQ, chorus, compression, reverb, pan, and quantity configurations otherwise to the distinctive track sections. The identical may well apply to other instruments likewise.&lt;br /&gt;
&lt;br /&gt;
The other finish in the coin is staying so hooked up on the rough mix you don't like when anything's modified. This ties in with level 2. Rough mixes are specifically that: rough, and not closing. Getting so connected to your rough you think that it is fantastic usually means you almost certainly haven't had plenty of time away from your track solely, so once you go back, you'll comprehend what it needs immediately after attaining some perspective for any week and resetting your ears.&lt;br /&gt;
&lt;br /&gt;
The art of mixing provides a lot to carry out with maximizing the arrangement, so starting off that has a good arrangement just, properly, is sensible. Once more that is a wonderful opportunity to examine for tracks that do not belong, and perhaps you will find just one or two spots where points clash or possibly a slight website traffic jam occurs. Here is the spot to wash issues up, that way you happen to be doing some thing you might be creatively ok with and also your mixer would not ought to decode your ideas.&lt;br /&gt;
&lt;br /&gt;
Focus on the busiest aspects of your mixes to begin with. This could be the hook (chorus), or bridge part, which is where by your mixes tend for getting absent from you the most. While you listen, produce a determination concerning no matter whether or not Every Track and every Solitary LAYER definitely Must be within the blend Continuously. Mute / un-mute and add / get rid of tracks one particular at a time and energy to examine their contribution on the effect of your track. It might be necessary to strip away a number of individuals layers if you want for your mix to sound extra punchy and energetic.&lt;br /&gt;
&lt;br /&gt;
Keep on there, Timba Jr, thrust back that duplication deadline! This may at the outset seem to be ridiculously apparent, but this can be the quantity 1 issue which makes finishing new music properly, so tough. It started out fantastic, but when you listen to the finished product or service, it just will not speak to you personally the way other recordings do. Here is the place issues went improper: you either mixed it by yourself with none experience, or you didn't help the mixer obtain the most effective from the tracks. Chances are you'll be sure you happen to be carried out recording, you send off the tracks, but then you definitely finish up sending a lot more tracks, and a lot more redos, and further sections; the mixing gig just turned into the monitor management gig.&lt;br /&gt;
&lt;br /&gt;
Searching for more details about [http://samuelcohen1230.posterous.com/essential-methods-to-acquire-an-excellent-mix Guidelines for getting Your Songs Mixes Rockin] , check out my website today to learn much more information here [http://patricklambe13.page.tl/Vital-Actions-To-receive-A-great-Mix-To-your-Single.htm Very important Ways To receive A terrific Combine On your Solitary] and [http://www.jukeboxalive.com/blog.php?blog_id=10069533 Critical Steps To obtain An awesome Combine To your Single]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/df_OyadmTqLdXgh-XXAGN0ooKyU/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/df_OyadmTqLdXgh-XXAGN0ooKyU/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/df_OyadmTqLdXgh-XXAGN0ooKyU/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/df_OyadmTqLdXgh-XXAGN0ooKyU/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/6x0IQp8NH-c" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 11:48:48 GMT</pubDate>			<dc:creator>HiersMebane260</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:HiersMebane260</comments>		</item>
		<item>
			<title>CAISIBAN419</title>
			<link>http://en.wikipilipinas.org/index.php?title=CAISIBAN419</link>
			<description>&lt;p&gt;Summary: New page: Passive take-home pay streams; that's how the creamy make money, still in a downcast economy. You almost certainly sweat for your paycheck, but they don't. They number out smart behavior t...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Passive take-home pay streams; that's how the creamy make money, still in a downcast economy. You almost certainly sweat for your paycheck, but they don't. They number out smart behavior to compose money devoid of working for it day in and day out.&lt;br /&gt;
&lt;br /&gt;
Writers now hold many opportunities to bring in money online. a number of websites distribute revenue beginning adverts to be found around your article. as someone clicks an advert on your summon you willpower earn adsense revenue. supplementary sites spirit pay per editorial view whereas some desire pay per thousand views. At to start with it may seem so as to you are assembly cents slightly than dollars, but jab with it! gratify really is ruler when it comes to manufacture passive takings online from beginning to end writing articles. You should aim too enter good quality, exciting articles with the intention of cover fashionable subjects or subjects to facilitate are not without difficulty out old and therefore hold a longer mantelpiece life so to speak.&lt;br /&gt;
&lt;br /&gt;
&amp;lt;img src=http://i.ytimg.com/vi/61s16B3VrU4/0.jpg alt=Make Passive Income amid Mini Sites.&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Passive income, on the additional hand, is takings that does not need your nonstop involvement. approximately kinds of passive returns you may be familiar together with include owning leasing property, royalties on an invention or creative work, and set of contacts marketing. If you fancy to earn more, job less, and boast a good retirement, you're going away to hold to initiate creating take-home pay streams with the purpose of do not insist on your nonstop involvement. Whether you're merely starting your business, or you've been organization it a while, the more rapidly you initiate thinking on the subject of how you are going away to remove your affair model to fashion more passive income, the more rapidly you can realize personal and pecuniary freedom.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Now, I'm not talking on the subject of MLM, but regarding becoming an partner (thing agent or virtual sales person). Basically, you poster up for at no cost and dispatch visitors to the merchant's site.&lt;br /&gt;
&lt;br /&gt;
With cash tight proper now, and employment uncertain, heaps of nation looking for creative habits to earn a little extra cash. countless are spiraling to the Internet.&lt;br /&gt;
&lt;br /&gt;
 [http://www.PassiveCashFlowClub.com You Need To Start to Make Passive Income Online Now]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/ChDm-L_RLsM_d7tEEZjgeylIMX4/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ChDm-L_RLsM_d7tEEZjgeylIMX4/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/ChDm-L_RLsM_d7tEEZjgeylIMX4/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ChDm-L_RLsM_d7tEEZjgeylIMX4/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/b5xlFbbMk58" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 11:44:29 GMT</pubDate>			<dc:creator>CAISIBAN419</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:CAISIBAN419</comments>		</item>
		<item>
			<title>SheldonDecoteau605</title>
			<link>http://en.wikipilipinas.org/index.php?title=SheldonDecoteau605</link>
			<description>&lt;p&gt;Summary: New page: Breast cancer specifics each female  Yes, radiation can be used in mammography. But the total is so smaller that whether or not there is any elevated probability, it can be likely for bein...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Breast cancer specifics each female&lt;br /&gt;
&lt;br /&gt;
Yes, radiation can be used in mammography. But the total is so smaller that whether or not there is any elevated probability, it can be likely for being extremely minimum when compared with the quantity of bonus you obtain by possessing lumps detected early. A mammogram may help you to detect a lump substantially before you can experience it. Which improves your chances of survival.&lt;br /&gt;
&lt;br /&gt;
Gals with lumpy or dense boobs had been before thought to own higher challenges. But, these days, researchers feel you can find no this sort of link. Lumpy or dense tissue can make it hard to distinguish the traditional tissue from the cancerous tissue. So, your physician may possibly normally advise your mammograms to get followed by an ultrasound examination.&lt;br /&gt;
&lt;br /&gt;
Greater than 80 prosent of these kinds of lumps are noncancerous. These may be brought about because of accumulation of fluid (cysts), fatty tissue (lipoma), fibrous tissue (fibroma) etc. Nevertheless, will not neglect any transform in any respect. Check with a doctor in case you realize just about any improve. Detecting most cancers early can imply a big distinction as part of your lifestyle.&lt;br /&gt;
&lt;br /&gt;
There are a few claims that underwire bras compress the lymphatic process resulting in accumulation of toxins, and therefore creating most cancers. Most scientists, nevertheless, point out that it unscientific. You can find no scientific proof to demonstrate that donning underwire or tight bras can boost your perils. Go forward and use a bra you will be most comfy in. Bras have nothing to perform using your probability for cancer.&lt;br /&gt;
&lt;br /&gt;
The oncologist could prescribe chemotherapy which involves a chemical substance utilised for your cure of infectious ailments or perhaps the avoidance of conditions. This involves SERMs, aromatase inhibitors, and progestins. Wikipedia describes chemotherapy, inside the simplest feeling, since the therapy of an ailment by chemical compounds specifically by killing micro-organisms or cancerous cells.&lt;br /&gt;
&lt;br /&gt;
Sure, the danger improves with age. But, a girl isn't much too youthful to worry about breast most cancers. New tendencies show an increase of its incidence in younger age groups. This could be relevant to the modifications in life fashion or changes in the menstrual sequence. Right now, far more and much more ladies of their thirties are getting identified with the condition. The youngest individual We have study about was only several a long time previous at analysis. So, be sure to remember - you might be by no means also youthful for it!&lt;br /&gt;
&lt;br /&gt;
Most women worry that, if most cancers cells are identified, they will instantly must possess the breast taken out. Due to the perceived disfigurement that results from a mastectomy, it's a pretty true nightmare that every lady hopes by no means to have to deal with. You could choose comfort from the reality that lumpectomy (the removal of just the lump plus some with the regular tissue that surrounds it,) radiation treatment method and prescribed drugs are powerful alternate options which commonly, a mastectomy is definitely the last resort.&lt;br /&gt;
&lt;br /&gt;
Do you need more facts about [http://ewennraffert24155.tumblr.com Recognizing these breast cancer information] , please visit my website right away to learn more information on [http://blog.bizeso.com/BlogDetail.aspx?bid=604ca99e-1b35-4c72-ba74-474caf57f767 Discover the actual reality about breast cancer] and [http://ewennraffert24.insanejournal.com/521.html Understand the real real truth about breast cancer]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/q2hT4VnBZDqOdDHRZDQIHU7JZJo/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/q2hT4VnBZDqOdDHRZDQIHU7JZJo/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/q2hT4VnBZDqOdDHRZDQIHU7JZJo/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/q2hT4VnBZDqOdDHRZDQIHU7JZJo/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/MV73EN9ff0o" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 11:39:57 GMT</pubDate>			<dc:creator>SheldonDecoteau605</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:SheldonDecoteau605</comments>		</item>
		<item>
			<title>StiverGribble965</title>
			<link>http://en.wikipilipinas.org/index.php?title=StiverGribble965</link>
			<description>&lt;p&gt;Summary: New page: Now using the selection of designer purses, you could get the high-end styles of Chanel, Gucci, Bottega Veneta, Balenciaga, Louis Vuitton, Fendi, Chloe, Dior, Givenchy, Yves Saint Laurent,...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Now using the selection of designer purses, you could get the high-end styles of Chanel, Gucci, Bottega Veneta, Balenciaga, Louis Vuitton, Fendi, Chloe, Dior, Givenchy, Yves Saint Laurent, Prada and Alexandra Wang and Marc Jacobs for pretty economical costs. It's not a fashionable trend only with the rich and renowned. The domain has now enlarged. With these stunning equipment, you can flaunt any sort of bag and vogue. Obtaining in the correct spot is not going to melt away a hole into your pocket!&lt;br /&gt;
[http://www.happy-handbags.com www.Happy-handbags.com]&lt;br /&gt;
There is a vast wide range with the designer handbags, because they emulate the sophisticated characteristics of just about every key designer, whose vogue is definitely the hottest rage during the period. These handbags will not be only created for girls but in addition preserve the male clientele in mind. The problem with designer handbags and the male clientele is usually that males are usually extremely apprehensive about acquiring them, despite the fact that they are available in a range of extremely smooth and clever masculine designs. However, the fact that you can find the worry of social stigma, coupled aided by the large rates of these handbags means that they can be only utilized by the quite loaded and modern or the in different ways oriented. Now, with designer oriented handbags, adult males will even locate manner and fee efficiency in substance and design and style underneath the similar umbrella of items. It can be hoped that the men?¡¥s?¡¥ section in designer bags will probably prosper as efficiently since the female counterpart. They can be now equally style conscious and look properly groomed.&lt;br /&gt;
[http://www.happy-handbags.com Replica Handbags]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/Z5DSZUS31XRgefgb8D7ngBXWdDM/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Z5DSZUS31XRgefgb8D7ngBXWdDM/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/Z5DSZUS31XRgefgb8D7ngBXWdDM/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Z5DSZUS31XRgefgb8D7ngBXWdDM/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/4LhEeRq4728" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 11:31:20 GMT</pubDate>			<dc:creator>StiverGribble965</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:StiverGribble965</comments>		</item>
		<item>
			<title>RameyHolte759</title>
			<link>http://en.wikipilipinas.org/index.php?title=RameyHolte759</link>
			<description>&lt;p&gt;Summary: New page: Now together with the selection of designer purses, you can acquire the high-end styles of Chanel, Gucci, Bottega Veneta, Balenciaga, Louis Vuitton, Fendi, Chloe, Dior, Givenchy, Yves Sain...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Now together with the selection of designer purses, you can acquire the high-end styles of Chanel, Gucci, Bottega Veneta, Balenciaga, Louis Vuitton, Fendi, Chloe, Dior, Givenchy, Yves Saint Laurent, Prada and Alexandra Wang and Marc Jacobs for extremely inexpensive rates. It is actually no more a fashionable craze only from the loaded and renowned. The domain has now enlarged. With these wonderful accessories, you can flaunt any sort of bag and trend. Purchasing with the appropriate spot will never burn up a hole into your pocket!&lt;br /&gt;
[http://www.happy-handbags.com www.Happy-handbags.com]&lt;br /&gt;
There is a broad wide variety on the designer purses, due to the fact they emulate the trendy characteristics of each significant designer, whose manner would be the most up-to-date rage inside the season. These handbags are usually not only designed for women of all ages but additionally hold the douleur clientele in your mind. The trouble with designer handbags as well as the male clientele is males are frequently very apprehensive about shopping for them, even though they come in a variety of pretty modern and intelligent masculine models. Nonetheless, the truth that there exists the concern of social stigma, coupled with the superior rates of those handbags implies that they are really only employed by the quite prosperous and stylish or even the in a different way oriented. Now, with designer oriented purses, gents may also uncover vogue and fee efficiency in content and style under the same umbrella of merchandise. It really is hoped that the men?¡¥s?¡¥ part in designer bags will flourish as efficiently for the reason that female counterpart. They are now equally style conscious and appear well groomed.&lt;br /&gt;
[http://www.happy-handbags.com Replica Handbags]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/Oc1R7JX6GcTAq5TmKmfTnBC3no4/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Oc1R7JX6GcTAq5TmKmfTnBC3no4/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/Oc1R7JX6GcTAq5TmKmfTnBC3no4/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Oc1R7JX6GcTAq5TmKmfTnBC3no4/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/tfdQpEGTsSY" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 10:45:21 GMT</pubDate>			<dc:creator>RameyHolte759</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:RameyHolte759</comments>		</item>
		<item>
			<title>BabitaCarrier868</title>
			<link>http://en.wikipilipinas.org/index.php?title=BabitaCarrier868</link>
			<description>&lt;p&gt;Summary: New page: To purchase [http://britishgardenathanoversquare.com/|http://calgaryappointmentservices.com/|http://desstore.com/|http://elvaciocomollenura.com/|http://environmentalcausemarketing.com/|htt...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;To purchase [http://britishgardenathanoversquare.com/|http://calgaryappointmentservices.com/|http://desstore.com/|http://elvaciocomollenura.com/|http://environmentalcausemarketing.com/|http://fisher-connect.com/|http://fratellicafe.net/|http://hollowshoulder.com/|http://khaochunto.com/|http://lifewithbabs.com/|http://linksystocisco.com/|http://meediafeedia.com/|http://nybook.org/|http://okvoice.org/GetFacebookFansNow!] and boost your fan page internet site visitors is always to rise your odds of gross sales using the social media. When women and men assume social media, most people could really feel of a exceptional sociable network. Twitter, Facebook, Linked-in, and MySpace could possibly appear to thoughts. There are several distinct sociable networks, but only one particular that is definitely the most preferred. Facebook! This has surpassed any other social community out there. At incredibly initially men and women didn't think it would actually surpass MySpace simply because you'll be able to not customize it as significantly as MySpace. Even devoid of becoming inside a position to customize it and communicate one's correct character it still is actually a LOT a lot more popular than MySpace.com.&lt;br /&gt;
&lt;br /&gt;
Quite a few persons will sit on Facebook for a number of hrs just about every single day. This can be what tends to create Facebook a silver mine for corporations. People are either updating their standing studying their pals standing or taking part in games. What ever the trigger that retains them logged into Facebook just about every day is what keeps Facebook the finest arrange to advertise your business enterprise.&lt;br /&gt;
&lt;br /&gt;
As a way to entirely get every single small thing you'll be able to out of Facebook, you have to generate a fan-page. A fan-page is just a page in which you attempt to obtain as pretty a few men and women as it is possible to to like your web page. Once you have built up your followers on your fan-page, then you could post your advertisements. That ad is going to visit just about every single single fan's news-feed. This really is what you need!! The quite a bit a lot more followers you've got the a good deal a lot more folks you've studying your advertisements&lt;br /&gt;
&lt;br /&gt;
Depending how you go about acquiring fans, you could target the viewers you desire. In case your organization is geared toward wellness and fitness, you could possibly choose to get your followers by way of wellness and fitness forums or twitter working with fitness-minded persons today. But one of the most beneficial ventures and also the greatest method to get your fans is always to buy Facebook fans. This is an investment that can pay you again for a lot of years to arrive. There's no other business enterprise enterprise price that can return your expense, plus most, for numerous years.&lt;br /&gt;
&lt;br /&gt;
One technique to appear in the expense of shopping for followers for the fan-page is when you were going to put an ad, you'd need to spend for it. The ad would only final a fastened level of time. Most advertisements will run to get a day, a 1 week, and some could even final a complete year. After you invest in Facebook followers, that you are not shopping for 1 ad with any time restrict on it. That you are getting the option for unlimited ads for an limitless volume of time. Years and quite a few years, or the size of time your fan-page is reside. As Facebook continues to obtain bigger and higher, so your funding could double and triple.&lt;br /&gt;
&lt;br /&gt;
A fan-page is with out doubt certainly one of the greatest approaches to go when you are seeking to advertise your company. You are able to even construct up your Facebook and fan-page and marketplace other men and women's corporations!! Quite a bit of organizations usually do not recognize Facebook, so it could be a enormous benefit to you should you construct a sizable fan-page and have a large number of followers. It may perhaps appear like a tough job, but for those who purchase Facebook fans, you might have all folks folks that you can advertise your enterprise to.&lt;br /&gt;
&lt;br /&gt;
It can be the funding that you just could make that may retain you reaping the rewards to get a prolonged time. Take into account the alternative to buy Facebook followers to save you so quite a bit time, and dollars. Surely an investment worth generating! [http://britishgardenathanoversquare.com/|http://calgaryappointmentservices.com/|http://desstore.com/|http://elvaciocomollenura.com/|http://environmentalcausemarketing.com/|http://fisher-connect.com/|http://fratellicafe.net/|http://hollowshoulder.com/|http://khaochunto.com/|http://lifewithbabs.com/|http://linksystocisco.com/|http://meediafeedia.com/|http://nybook.org/|http://okvoice.org/GetFacebookFansNow!]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/wFfkGAZyoOLDW36saOjRu2dp5SU/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/wFfkGAZyoOLDW36saOjRu2dp5SU/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/wFfkGAZyoOLDW36saOjRu2dp5SU/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/wFfkGAZyoOLDW36saOjRu2dp5SU/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/cwf0jP6zYUc" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 10:35:39 GMT</pubDate>			<dc:creator>BabitaCarrier868</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:BabitaCarrier868</comments>		</item>
		<item>
			<title>RichburgEscobar188</title>
			<link>http://en.wikipilipinas.org/index.php?title=RichburgEscobar188</link>
			<description>&lt;p&gt;Summary: New page: Hints For buying a Made use of Vehicle  Even before negotiating the costs, the title as well as other legitimate files on the autos should be checked thoroughly. During the second hand aut...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Hints For buying a Made use of Vehicle&lt;br /&gt;
&lt;br /&gt;
Even before negotiating the costs, the title as well as other legitimate files on the autos should be checked thoroughly. During the second hand autos, the titles in the autos are a few occasions the problem and even they may be fraudulent occasionally. Also another documents and background papers from the automobiles should be checked as several of the situations the legal fits and incident complications are pending within the utilised automobiles which happens to be not disclosed on the time marketing and down the road it may possibly make large mess for that purchaser. So, it really is strictly encouraged to check the title in the car, documents, heritage ebook, deal with from the operator and various legal methods that necessary to get fulfilled before making the ultimate repayments.&lt;br /&gt;
&lt;br /&gt;
checked with the trustworthy mechanic of yours as any of your further more care or steps should be taken only after examining the car or truck ailment. The engine and the many other inner elements need to be scrutinized as being the price of repairing them is very better. You'll find lots of on the instances in which the next hand automobile repairing cost exceeds the price of latest cars. Also the mechanic on the auto owner should not be dependable only. So, to start with the checking of the auto must be done with keen treatment by the trusted mechanic.&lt;br /&gt;
&lt;br /&gt;
Prepare to get the automobile checked in excess of by a mechanic in the event you know 1 in advance of you choose to create that order and hand around your challenging attained dollars. In the event you will not know a mechanic there are numerous firms for instance the AA inside the Uk who provide a services which you could for just a fee organize for one of their inspectors to give a car a look at above ahead of you make the decision to invest in it.&lt;br /&gt;
&lt;br /&gt;
Subsequent you should ascertain exactly how much the automobile will probably expenditure once you will get it. Along with comparing the mileage ratings for that automobile that you're interested in you have to take into consideration what it is going to expenditure to maintenance the auto also. You will discover a lot of websites on the web together with the likes of fueleconomy.gov which will provide you with the EPA mileage figures for virtually any motor vehicle which has been produced from 1986 to 2008. As well as web sites similar to this may even tell you what varieties of greenhouse gasoline emissions the motor vehicle produces annually likewise.&lt;br /&gt;
&lt;br /&gt;
In the event you intend to buy from a web-based auction site it can be a good suggestion to hold out some checks ahead of earning a bid. In addition to executing the standard checks as brought up in suggestions 6 and seven you'll want to start looking carefully at the seller too, particularly should they seem to be selling a great deal of autos by way of these web-sites.&lt;br /&gt;
&lt;br /&gt;
Searching for more facts about [http://www.zimbio.com/General/articles/Ts4jmBO1yMs/Recommendations+buying+Employed+Vehicle?add=True A few Elements Wise Buyers Consider In advance of Obtaining Employed Autos] , check out my website immediately to learn much more information here [http://www.flixya.com/blog/4587835/Tips-to-take-into-consideration-Though-Shopping-for-Low-cost-Second-Hand-Cars Hints For getting a Utilized Vehicle] and [http://www.flixya.com/blog/4587809/Three-Things-Smart-Customers-Contemplate-Well-before-Buying-Utilised-Cars Hints to take into account Though Obtaining Low cost Second Hand Automobiles]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/SQVF2RWPVHuXBVTG_h298MAVZ-M/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/SQVF2RWPVHuXBVTG_h298MAVZ-M/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/SQVF2RWPVHuXBVTG_h298MAVZ-M/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/SQVF2RWPVHuXBVTG_h298MAVZ-M/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/vyZU4SWkhOo" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 10:08:12 GMT</pubDate>			<dc:creator>RichburgEscobar188</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:RichburgEscobar188</comments>		</item>
		<item>
			<title>Janna cachola</title>
			<link>http://en.wikipilipinas.org/index.php?title=Janna_cachola</link>
			<description>&lt;p&gt;Summary: [[Janna cachola]] moved to [[Janna Cachola]]&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;!-- Metadata: see [[Wikipedia:Persondata]] --&amp;gt;&lt;br /&gt;
{{Infobox person&lt;br /&gt;
| name        = Janna Cachola&lt;br /&gt;
| image  = Janna Cachola headshot.jpg&lt;br /&gt;
| birth_date  = {{birth date and age|1989|10|29|df=y}}&lt;br /&gt;
| birth_place = [[Manila]], [[Philippines]]&lt;br /&gt;
| nationality = [[New Zealander]]&lt;br /&gt;
| other_names = Lyka&lt;br /&gt;
| occupation  = [[Actress]], [[Singer]], [[Dancer]], [[Model (person)|model]], [[stuntwoman]], [[Make-up artist]]&lt;br /&gt;
| agent = [http://www.AliMcd.co.nz Ali McD Agency], Dunedin, New Zealand&lt;br /&gt;
| genre =  [[Hip hop]] [[R&amp;amp;B]] [[Pop]] [[Dance]]&lt;br /&gt;
| years_active = 1996-present&lt;br /&gt;
| website     =  &lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
'''Janna Cachola, ''' also known as '''Janna C''', (born 29 October 1989) is an actress, singer and model  based in New Zealand. She has been performing since 1996, but rose to fame in 2010, when she was chosen to be a part of ''[[Miss Saigon]]'' in New Zealand.&lt;br /&gt;
&lt;br /&gt;
==Early life==&lt;br /&gt;
Cachola was born in [[Manila]], [[Philippines]]. She was raised as a Christian. Cachola is of mixed cultural background: Italian, [[Filipino]], Spanish, and Hawaiian. She was attracted to performing at a very young age. She was trained in vocals at the [[Ryan Cayabyab]] Music Studio. She was a child model and actress before departing for New Zealand. She spent most of her life in South Auckland, New Zealand.&lt;br /&gt;
&lt;br /&gt;
Cachola is related to [[Filipino]] entertainers: Juvy Cachola, an actress of [[Sampaguita Pictures]] and Jean Altavas,beauty queen, model, and now producer of Kisapmata productions. Her great-grandmother, Marcelina Cachola, was a [[World War II]] heroine who went face-to-face with the Japanese to appeal for the freedom of the men captured in [[Paete, Laguna]]. &lt;br /&gt;
&lt;br /&gt;
==Career==&lt;br /&gt;
===Music===&lt;br /&gt;
Cachola started taking singing seriously at the age of 14 after a 'life changing' visit to the United States. As she returned to New Zealand, she joined her church's performing-arts team.&lt;br /&gt;
&lt;br /&gt;
In 2006, she auditioned for  New Zealand Idol Season 2 but failed to go through the next rounds. The same year, she performed at various bars in the [[Philippines]] and recorded a self-titled album. &lt;br /&gt;
&lt;br /&gt;
In 2008, Cachola was discovered by a Kiwi rapper Joshua Webb and was chosen to be a back-up singer for Parachute Music Festival 2008, one of the biggest Christian festivals in the southern hemisphere. Soon after, she sang two tracks - “Society is a Warzone” and “Keep on” - for Webb's album. Later that year, another Kiwi rap artist Jzaman (Shaun Jervis) chose her to appear on his track “Back against the wall” for his album “Comfort Zone.” &lt;br /&gt;
&lt;br /&gt;
Cachola has performed all over New Zealand and the [[Philippines]] as a back-up singer under the stage name 'Lyka', however, was changed due to confusion with Filipino R&amp;amp;B artist [[Kyla]].&lt;br /&gt;
&lt;br /&gt;
===Acting ===&lt;br /&gt;
In 2009, Cachola took a step back from music, to pursue her first passion, acting. She got herself an agent in Auckland that got her parts as a background actor in various TV shows/commercials/music videos filmed in New Zealand. &lt;br /&gt;
&lt;br /&gt;
She moved to Dunedin in 2009 and was casted in local musical theater. In 2010 she was in [[Miss Saigon]] musical in Dunedin, New Zealand with Tina Braganza and internet sensation Kimpoy Feliciano.&lt;br /&gt;
&lt;br /&gt;
===Modeling===&lt;br /&gt;
In 2011, Cachola admitted that she was feeling depressed and was low in self-esteem, so she signed on to do a confidence and modeling course with Dunedin modeling agency.  She was trained in Modeling by New Zealand's Next Top Model Cycle 2 'twins' Nellie Jenkins &amp;amp; Elza Jenkins and agency director  Aliana McDaniel.  She was then discovered by a US based blogger, model and author Isobella Jade, who named Cachola “Petite Model of the Week.”&lt;br /&gt;
&lt;br /&gt;
==Filmography==&lt;br /&gt;
{| border=&amp;quot;2&amp;quot; cellpadding=&amp;quot;4&amp;quot; cellspacing=&amp;quot;0&amp;quot; style=&amp;quot;margin: 1em 1em 1em 0; background: #f9f9f9; border: 1px #aaa solid; border-collapse: collapse; font-size: 95%;&amp;quot;&lt;br /&gt;
! Year&lt;br /&gt;
! Title&lt;br /&gt;
! Role&lt;br /&gt;
! Notes&lt;br /&gt;
|-&lt;br /&gt;
| 2006 || Taglish || Cora ||  &lt;br /&gt;
|-&lt;br /&gt;
| 2008 || Story of her love|| Lana ||&lt;br /&gt;
|-&lt;br /&gt;
| 2011 || Mirage || Private || short &lt;br /&gt;
|-&lt;br /&gt;
| 2011 ||Detective Doctor Felon Mystery Woman|| Scarlet ||&lt;br /&gt;
|-&lt;br /&gt;
|   || Bella Bandida || Isabella ||&lt;br /&gt;
|-&lt;br /&gt;
|- bgcolor=&amp;quot;#CCCCCC&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! colspan=&amp;quot;4&amp;quot; style=&amp;quot;background: LightSteelBlue;&amp;quot; | Television&lt;br /&gt;
|- bgcolor=&amp;quot;#CCCCCC&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! Year&lt;br /&gt;
! Title&lt;br /&gt;
! Role&lt;br /&gt;
! Notes&lt;br /&gt;
|-&lt;br /&gt;
|2006|| New Zealand Idol || as herself ||&lt;br /&gt;
|-&lt;br /&gt;
|2009|| Power Rangers RPM || Venjix worker||&lt;br /&gt;
|-&lt;br /&gt;
|- bgcolor=&amp;quot;#CCCCCC&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! colspan=&amp;quot;4&amp;quot; style=&amp;quot;background: LightSteelBlue;&amp;quot; | Theater&lt;br /&gt;
|-&lt;br /&gt;
| 2010 || [[Miss Saigon]] || female company|| Regent Theatre, Dunedin, New Zealand&lt;br /&gt;
|-&lt;br /&gt;
| 2012 ||Worse things happen at sea||Margaret||Globe Theatre, Dunedin,New Zealand&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
==Discography==&lt;br /&gt;
{|class=&amp;quot;wikitable&amp;quot; style=&amp;quot;font-size: 90%;&amp;quot; border=&amp;quot;2&amp;quot; cellpadding=&amp;quot;4&amp;quot; background: #f9f9f9;&lt;br /&gt;
|- align=&amp;quot;center&amp;quot;&lt;br /&gt;
!Year&lt;br /&gt;
!Title&lt;br /&gt;
!Artist&lt;br /&gt;
!Album&lt;br /&gt;
|-&lt;br /&gt;
|2006&lt;br /&gt;
|&lt;br /&gt;
|Lyka&lt;br /&gt;
|'Self-titled'&lt;br /&gt;
|-&lt;br /&gt;
|2006&lt;br /&gt;
|Disneyland&lt;br /&gt;
|Lyka&lt;br /&gt;
|&lt;br /&gt;
|-&lt;br /&gt;
|2006&lt;br /&gt;
|You&lt;br /&gt;
|Lyka&lt;br /&gt;
|&lt;br /&gt;
|-&lt;br /&gt;
|2008&lt;br /&gt;
|Society Is A Warzone&lt;br /&gt;
|Joshua Webb feat. Lyka&lt;br /&gt;
|Nothing in this world EP&lt;br /&gt;
|-&lt;br /&gt;
|2008&lt;br /&gt;
|Keep On&lt;br /&gt;
|KOD feat. Lyka&lt;br /&gt;
|Nothing in this world EP&lt;br /&gt;
|-&lt;br /&gt;
|2009&lt;br /&gt;
|Back Against The Wall&lt;br /&gt;
|Jzaman feat Lyka&lt;br /&gt;
|Comfort Zone&lt;br /&gt;
|-&lt;br /&gt;
|2009&lt;br /&gt;
|Ambulance&lt;br /&gt;
|Lyka&lt;br /&gt;
|-&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
{{Reflist}}&lt;br /&gt;
*{{cite web| url=http://www.whosdatedwho.com/tpx_8669862/janna-cachola/|title=Janna Cachola and William Tait-Jamieson|publishers=whosdatedwho.com|2012-02-14|accessdate=2012-04-11}}&lt;br /&gt;
*{{cite web|url=http://www.abs-cbnnews.com/.../wilma-doesnt-poses-topless-playboy-ph|title=Wilma Doesnt poses for playboy philippines|publisher=abs-cbnnews.com|2012-04-04|accessdate=2012-04-11}}&lt;br /&gt;
*{{cite web| url=http://www.famousfilipino.com/content/view/353/119 |title=Famous Filipino by FamousFilipino.com |publisher=Famousfilipino.com|2011-11-21|accessdate=2012-04-11}}&lt;br /&gt;
*{{cite web|url=http://www.hollywoodstarshoney.com/entertainment-asia/janna-cachola-off-screen-romance.html |title=Offscreen romance by hollywoodstarshoney.com|publisher=hollywoodstarshoney.com|2011-29-11|accessdate=2012-04-11}}&lt;br /&gt;
*{{cite web| url=http://www.odt.co.nz/news/dunedin/178525/head-heights-not-catwalk-essential |title=Head heights not a catwalk esentia- Otago Daily Times By Ellie Contsantine &amp;amp;33124; The Otago Daily Times&amp;gt;&amp;gt;News|publisher=Odt.co.nz| 2011-09-21|accessdate=2012-04-09}}&lt;br /&gt;
*{{cite web| url=http://www.petitemodelingtips.com/2011/08/petite-model-of-week-is-janna.html |title=Petite model of the week is Janna by Isobella Jade|publisher=petitemodelingtips.com|2011-03-07|accessdate=2012-04-11}}&lt;br /&gt;
* {{cite web|url=http://www.philstar.com/Article.aspx?articleId=618091 |title=Legends of Pinoy Folk Rock together in show - FUNFARE By Ricardo F. Lo &amp;amp;#124; The Philippine Star &amp;gt;&amp;gt; News &amp;gt;&amp;gt; Entertainment |publisher=Philstar.com |date=2010-10-05 |accessdate=2012-03-12}}&lt;br /&gt;
&lt;br /&gt;
==External links==&lt;br /&gt;
*[http://www.imdb.com/name/nm4733211/ Janna Cachola] on ''IMDb''&lt;br /&gt;
*[http://www.twitter.com/LadyCachola Janna Cachola] official Twitter&lt;br /&gt;
*[http://www.alimcd.co.nz/ Ali McD model agency]&lt;br /&gt;
*[http://www.mcdanielpower.co.nz/ McDaniel and Power actor management]&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
&lt;br /&gt;
{{DEFAULTSORT:Cachola, Janna}}&lt;br /&gt;
[[Category:1989 births]]&lt;br /&gt;
[[Category:Filipino actors]]&lt;br /&gt;
[[Category:Filipino child actors‏‎]]&lt;br /&gt;
[[Category:Filipino female models]]&lt;br /&gt;
[[Category:Living people]]&lt;br /&gt;
[[Category:Filipino singers]]&lt;br /&gt;
[[Category:New Zealand actors]]&lt;br /&gt;
[[Category:Film actors by nationality]]&lt;br /&gt;
[[Category:New Zealand film actors]]&lt;br /&gt;
[[Category:New Zealand female singers]]&lt;br /&gt;
[[Category:New Zealand Idol]]&lt;br /&gt;
[[Category:People from Manila]]&lt;br /&gt;
[[Category:Musical theatre actors]]&lt;br /&gt;
[[Category:Filipino Christians]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/af24b6idNFe0JiOqbo-5MOztLEc/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/af24b6idNFe0JiOqbo-5MOztLEc/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/af24b6idNFe0JiOqbo-5MOztLEc/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/af24b6idNFe0JiOqbo-5MOztLEc/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/ac1Ksik5ofc" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 28 May 2012 06:25:57 GMT</pubDate>			<dc:creator>RigFamily</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Janna_cachola</comments>		</item>
		<item>
			<title>Animal Welfare Act of 1998</title>
			<link>http://en.wikipilipinas.org/index.php?title=Animal_Welfare_Act_of_1998</link>
			<description>&lt;p&gt;Summary: New page: The '''Republic Act 8485''', otherwise known as the '''Animal Welfare Act of 1998''', is an act to promote animal welfare in the [[Philippines]]. It was passed during former President [[Fi...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The '''Republic Act 8485''', otherwise known as the '''Animal Welfare Act of 1998''', is an act to promote animal welfare in the [[Philippines]]. It was passed during former President [[Fidel V. Ramos|Fidel V. Ramos']] term.&lt;br /&gt;
&lt;br /&gt;
==Purpose of the law==&lt;br /&gt;
Section 1 states that the act aims to protect and promote the welfare of all animals in the [[Philippines]] by supervising and regulating the establishment and operations of all facilities of all animals.&lt;br /&gt;
&lt;br /&gt;
Section 2 states that nobody shall establish, maintain and operate any animal facility (pet shop, kennel, veterinary clinic, veterinary hospital, stockyard, corral, stud farm or stock farm or zoo) without first securing from the [[Bureau of Animal Industry]] a certificate of registration. A certificate may be issued if facilities of such establishments are adequate, clean, and sanitary and will not be used to cause pain or suffering to the animals.&lt;br /&gt;
&lt;br /&gt;
Section 3 states that the Director of the [[Bureau of Animal Industry]] shall supervise and regulate the establishment and operation and maintenance of animal facilities and any other form or structure for the confinement of animals to provide maximum comfort while in transit and minimize incidence of sickness and death and prevent any cruelty from being inflicted upon animals.&lt;br /&gt;
&lt;br /&gt;
Section 4 states that it shall be the duty of any air, land, or water public utility which transports animals to provide adequate, clean, and sanitary facilities for the safe conveyance and delivery of animals. Sufficient food and water shall be provided to animals while in transit. No one shall transit any animal without a written permit from the Director of the [[Bureau of Animal Industry]]. Any form of cruelty shall be penalized. &lt;br /&gt;
&lt;br /&gt;
==Committee on Animal Welfare==&lt;br /&gt;
Section 5 states that a Committee on Animal Welfare attached to the [[Department of Agriculture]] is created to issue the necessary rules and regulations for the strict implementations of the provisions of the said Act. It includes the setting of safety and sanitary standards within thirty calendar days following its approval.&lt;br /&gt;
&lt;br /&gt;
The Committee is composed of the official representatives of the following:&lt;br /&gt;
*[[Department of Interior and Local Government]] (DILG) &lt;br /&gt;
*[[Department of Education]] (DepEd)&lt;br /&gt;
*[[Bureau of Animal Industry]] (BAI) of the [[Department of Agriculture]] (DA)&lt;br /&gt;
*[[Protected Areas and Wildlife Bureau]] (PAWB) of the [[Department of Environment and Natural Resources]] (DENR)&lt;br /&gt;
*National Meat Inspection Commission (NMIC) of the DA&lt;br /&gt;
*Agriculture Training Institute (ATI) of the DA&lt;br /&gt;
*Philippine Veterinary Medical Association (PVMA)&lt;br /&gt;
*Veterinary Practitioners Association of the Philippines (VPAP)&lt;br /&gt;
*Philippine Animal Hospital Association of the Philippines (PAHA)&lt;br /&gt;
*[[Philippine Animal Welfare Society]] (PAWS)&lt;br /&gt;
*Philippine Society for the Prevention of Cruelty to Animals (PSPCA)&lt;br /&gt;
*Philippine Society of Swine Practitioners (PSSP)&lt;br /&gt;
*Philippine College of Canine Practitioners (PCCP)&lt;br /&gt;
*Philippine Society of Animal Science (PSAS).&lt;br /&gt;
==Animal and its habitat's protection==&lt;br /&gt;
Section 6 states that it shall be unlawful to torture, neglect providing adequate care, sustenance or shelter or maltreat any animal. Killing of animals other than cattle pigs, goats, sheep, poultry, rabbits, carabaos, horses, deer and crocodiles is declared unlawful except during the following instances:&lt;br /&gt;
*When it is done as a part of religious rituals of an established religion or an ethnic custom of indigenous cultural groups&lt;br /&gt;
*When an animal is afflicted with an incurable and communicable disease as certified by a veterinarian&lt;br /&gt;
*When the killing is necessary to put an end to the misery suffered by an animal&lt;br /&gt;
*When it is done to prevent an imminent danger to the life of a human being&lt;br /&gt;
*When done to control animal population&lt;br /&gt;
*When an animal is killed after it has been used in an authorized research or experiment&lt;br /&gt;
&lt;br /&gt;
Section 7 states that every person shall protect the natural habitat of animals. Destruction of animal habitat is considered animal cruelty and its preservation is considered  a way of protecting animals.&lt;br /&gt;
&lt;br /&gt;
==Penalty for violations==&lt;br /&gt;
Section 8 states that a convicted person who violates any provision of this Act shall be punished by imprisonment of not less than six (6) months to not more than two (2) years or a fine of not less than one thousand pesos (P1,000.00) to not more than five thousand pesos (P5,000.00) or both at the discretion of the Court.&lt;br /&gt;
&lt;br /&gt;
==Criticisms==&lt;br /&gt;
According to an article about Animal Rights on About.com, one of the biggest criticisms of the Act is the exclusion of rats and mice, which make up the majority of animals used in research. Livestock are also excluded and there are no laws or regulations for the care of animals raised for food.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.chanrobles.com/republicactno8485.htm “Republic Act 8485”].''Chan Robles Virtual Law Library''.(Accessed on 25 May 2012)&lt;br /&gt;
*[http://onlovinganimals.blogspot.com/2012/02/philippines-animal-welfare-act-of-1998.html “Philippines. Animal Welfare Act of 1998. Amendments. HB 5849. Making a Good Thing Better.”].''On Loving Animals''.(Accessed on 25 May 2012)&lt;br /&gt;
*Lin, Doris.[http://animalrights.about.com/od/animallaw/a/AnimalWelfareAct.htm “Overview of the Animal Welfare Act”].''About.com: Animal Rights''.(Accessed on 25 May 2012)&lt;br /&gt;
*[http://www.tempo.com.ph/2011/nation-observes-animal-welfare-week/ “Nation observes Animal Welfare Week”].''Tempo''.(Accessed on 25 May 2012)&lt;br /&gt;
&lt;br /&gt;
==External links==&lt;br /&gt;
*[http://petiksatbp.wordpress.com/tag/animal-welfare-act-of-1998/ “Redefining “Animal Cruelty””].''Inside PETiks Doggie Day Care''.(Accessed on 25 May 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
[[Category:Philippine law]]&lt;br /&gt;
[[Category:Political and Public International Law]]&lt;br /&gt;
[[Category:Legal Codes]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/Kj9ILlSxP4Gsc26nkHPSZggRjeU/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Kj9ILlSxP4Gsc26nkHPSZggRjeU/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/Kj9ILlSxP4Gsc26nkHPSZggRjeU/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Kj9ILlSxP4Gsc26nkHPSZggRjeU/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/sdpxoqTzLTk" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 09:49:26 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Animal_Welfare_Act_of_1998</comments>		</item>
		<item>
			<title>Karl Roy</title>
			<link>http://en.wikipilipinas.org/index.php?title=Karl_Roy</link>
			<description>&lt;p&gt;Summary: New page: {{Infobox musical artist | name                      = Karl Roy | image                     =  | image_size                =  | alt                       =  | caption                   =  ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Infobox musical artist&lt;br /&gt;
| name                      = Karl Roy&lt;br /&gt;
| image                     = &lt;br /&gt;
| image_size                = &lt;br /&gt;
| alt                       = &lt;br /&gt;
| caption                   = &lt;br /&gt;
| birth_name                = &lt;br /&gt;
| birth_date                = {{Birth date|1968|05|25}} &lt;br /&gt;
| birth_place               = [[Manila]], [[Philippines]] &lt;br /&gt;
| death_date                = {{Death date and age|2012|03|13|1968|05|25}} &lt;br /&gt;
| death_place               =  [[Quezon City]], [[Metro Manila]], Philippines&lt;br /&gt;
| death_cause               = [[Cardiac arrest]]&lt;br /&gt;
| native_name               = &lt;br /&gt;
| native_name_lang          =&lt;br /&gt;
| nationality               = Filipino&lt;br /&gt;
| alias                     = &lt;br /&gt;
| origin                    = &lt;br /&gt;
| background                = solo_singer&lt;br /&gt;
| instrument                = Vocals&lt;br /&gt;
| genre                     = Rock&lt;br /&gt;
| occupation                = Rock singer&lt;br /&gt;
| years_active              = &lt;br /&gt;
| label                     = &lt;br /&gt;
| associated_acts           = [[P.O.T.]]&amp;lt;br/&amp;gt;[[Kapatid (band)|Kapatid]]&amp;lt;br/&amp;gt;Advent Call&lt;br /&gt;
| spouse                    = Dena Roy &lt;br /&gt;
| children                  = Arianna Roy &lt;br /&gt;
| relatives                 = Kathryn Roy (sister) &amp;lt;br&amp;gt; Kevin Roy (brother) &amp;lt;br&amp;gt; Jose Roy III (cousin) &amp;lt;br&amp;gt; Jose Roy, Sr. (grandfather)&lt;br /&gt;
| website                   = &lt;br /&gt;
| footnotes                 = &lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
'''Karl Roy''' (25 May 1968- 13 March 2012) was a [[Filipino]] rock singer.  He was the vocalist of three [[Filipino|Pinoy]] rock bands: POT, ''Kapatid'', and Advent Call. One of his famous songs was ''Luha'' which he performed with ''Kapatid''.&lt;br /&gt;
&lt;br /&gt;
==Early life==&lt;br /&gt;
Roy was the grandson of former Senator Jose Roy. He was also the older brother of Kevin Roy, the lead singer of Razorback. His first cousin, Jose “Judd” Roy III, was one of the defense lawyers of the impeachment trial of [[Philippines|Philippines]] Chief Justice [[Renato Corona]].&lt;br /&gt;
&lt;br /&gt;
==Music career==&lt;br /&gt;
Roy started his career in the '80s as frontman for Advent Call. Roy and his bandmates held court at the old Mayric's in [[España, Manila]] and Red Rocks on Scout Tobias, [[Quezon City]]. These places were considered to be the breeding grounds of today's hottest groups. Roy quit Advent Call when record labels went on a signing spree in the 1990s to capitalize on the local band explosion.&lt;br /&gt;
&lt;br /&gt;
It was only until he joined the funk rock group POT that he became known to the public after having had a major hit: a cover of the Advisor's ''“Yugyugan Na”''. POT, however, did not last long. Its members blamed Roy's alleged unpredictable behavior for the band's demise.&lt;br /&gt;
&lt;br /&gt;
He continued making music by joining the band ''Kapatid'' with Nathan Azarcon and Ira Cruz of Hijo. POT reformed in October 2011. ''Kapatid'' released two albums: a self-titled album in 2003 and ''Luha'' in 2006.&lt;br /&gt;
&lt;br /&gt;
Although Roy never had another major hit after ''“Yugyugan Na”'', his cult-figure status and reputation as crowd favorite landed him on the covers of music and lifestyle magazines. He was even chosen as a [[San Miguel]] Red Horse Beer endorser in 2007.&lt;br /&gt;
&lt;br /&gt;
==Death==&lt;br /&gt;
Karl Roy died on 13 March 2012 at age 43 due to cardiac arrest. Prior to his death, he was brought to  Cardinal Rufino Santos Hospital in [[San Juan]], straight to the intensive care unit, for he complained of difficulty in breathing. He was said to have been diagnosed with Pulmonary Edema or fluid accumulation in the lungs. &lt;br /&gt;
&lt;br /&gt;
In September 2007, after shooting the TV commercial with [[Joey Smith|Joey “Pepe” Smith]] and other Red Horse talents, he suffered a stroke which left his body half paralyzed for months. When asked what he thinks allows him to continue surviving life, he said that he needed people to validate if what he's feeling was real.&lt;br /&gt;
&lt;br /&gt;
Hours after his death, he became a top trending twitter topic on Twitter Philippines for fans and celebrities expressed grief over his death.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*Casal, Marj.[http://www.gmanetwork.com/news/story/251239/lifestyle/people/pinoy-rock-legend-karl-roy-dies-at-43 “Pinoy rock legend Karl Roy dies at 43”].''GMA News Online''.(Accessed on 25 May 2012)&lt;br /&gt;
*Ramos, NR.[http://www.mb.com.ph/articles/354120/karl-roy-rock-legend-dies “Karl Roy, Rock Legend Dies”].''mb.com.ph''.(Accessed on 25 May 2012)&lt;br /&gt;
*Concepcion, Pocholo.[http://entertainment.inquirer.net/33415/rock-star-karl-roy-one-of-local-music%E2%80%99s-best-acts-43 “Rock star Karl Roy, one of local music’s best acts; 43”].''Inquirer Entertainment''.(Accessed on 25 May 2012)&lt;br /&gt;
*Cruz, RG.[http://www.abs-cbnnews.com/nation/03/13/12/judd-roy-karl-roy-we-marched-our-own-beat “Judd Roy on Karl Roy: We marched to our own beat”].''ABSCBNnews.com''.(Accessed on 25 May 2012)&lt;br /&gt;
*[http://www.abs-cbnnews.com/entertainment/03/13/12/pinoy-rock-icon-karl-roy-dies “Pinoy rock icon Karl Roy dies”].''ABSCBNnews.com''.(Accessed on 25 May 2012)&lt;br /&gt;
&lt;br /&gt;
==External links==&lt;br /&gt;
*Oliva, Erwin.[http://ph.omg.yahoo.com/news/pinoy-rock-icon-karl-roy-passes-away.html “Pinoy rock icon Karl Roy passes away”].''Yahoo! OMG!''.(Accessed on 25 May 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
{{DEFAULTSORT:Roy, Karl}}&lt;br /&gt;
[[Category:Filipino male singers]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/7q7KWRqnwOapuIKefvlvbLyvaY0/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/7q7KWRqnwOapuIKefvlvbLyvaY0/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/7q7KWRqnwOapuIKefvlvbLyvaY0/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/7q7KWRqnwOapuIKefvlvbLyvaY0/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/j_nVPFzX4h4" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 25 May 2012 05:57:34 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Karl_Roy</comments>		</item>
		<item>
			<title>Independent Living Learning Centre</title>
			<link>http://en.wikipilipinas.org/index.php?title=Independent_Living_Learning_Centre</link>
			<description>&lt;p&gt;Summary: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The '''Independent Living Learning Centre''' (ILLC) is an institution which caters to the needs of childrens, adolescents and young adults with developmental conditions. It was established in July 2003 by Professor Archie David, an occupational therapy expert on transition programs. He is currently the ILLC's executive director. &lt;br /&gt;
&lt;br /&gt;
ILLC's aim is to improve the students' level of independence and quality of life. Such could be done by allowing them to be self-sufficient in areas of self-care, education, social interaction, work and recreation. To help generalize learning, practical learning activities for independent living are provided both in home and community settings. &lt;br /&gt;
&lt;br /&gt;
With the help of more than fifteen licensed occupational, physical and speech therapists, the school offers early intervention occupational, physical and speech therapies to enhance the psychosocial, speech and language, cognitive, fine and gross motor skills of its students. Peer group sessions are also being conducted to establish support systems and foster social interaction among youth with special needs. [[Special education]] (SPED) tutorials and classes are also being offered.&lt;br /&gt;
&lt;br /&gt;
Other than academic and non-academic offerings, ILLC provides students with educational trips, sports tournaments and outreach activities through the Rehabilitation and Empowerment of Adults and Children with Handicap (REACH) Foundation. ILLC also has a cafe and laundromat in the area where students are given the opportunity to work as part of the program. They are compensated for their work and are given a regular paycheck.&lt;br /&gt;
&lt;br /&gt;
ILLC also develops and offers home programs for special learners residing in far areas.&lt;br /&gt;
&lt;br /&gt;
ILLC's main center is located at 575 Wack-wack Road, [[Mandaluyong City]]. It also has regional centers in [[Cebu]] and [[Dipolog]].&lt;br /&gt;
&lt;br /&gt;
==Mission and Vision==&lt;br /&gt;
The ILLC aims to actively participate in empowering more individuals with special needs to become happy, integrated and productive members of the society. &lt;br /&gt;
&lt;br /&gt;
Furthermore, it envisions itself to be the country's leading and self-sustaining hub for people with special needs. Its programs, amenities, and service will make it an important resource for [[Filipino|Filipinos]].&lt;br /&gt;
&lt;br /&gt;
==Program and services==&lt;br /&gt;
ILLC's services focus on enhancing skills in different areas of development. These services include:&lt;br /&gt;
*Speech and language&lt;br /&gt;
#Pre-speech training&lt;br /&gt;
#Language and congnitive stimulation&lt;br /&gt;
#Articulation, voice and fluency training&lt;br /&gt;
#Alternative communication training&lt;br /&gt;
*Pyscho-social&lt;br /&gt;
#Behavior modification program&lt;br /&gt;
#Social skills training&lt;br /&gt;
*Sensory-perceptual&lt;br /&gt;
#Sensory integration program&lt;br /&gt;
#Perceptual skills training&lt;br /&gt;
*Oral-motor feeding&lt;br /&gt;
#Oral-motor training&lt;br /&gt;
#Dysphagia (difficulty in swallowing) management&lt;br /&gt;
*Pre-speech training&lt;br /&gt;
#Language and cognitive stimulation&lt;br /&gt;
#Articulation, voice and fluency training&lt;br /&gt;
*Adaptive behavior&lt;br /&gt;
#Activities of daily living (ADL) training, pre-vocational training&lt;br /&gt;
#Skills training and play therapy&lt;br /&gt;
*Gross motor skills, posture, endurance and fitness&lt;br /&gt;
#Gross motor skills training&lt;br /&gt;
#Advanced motor skills training&lt;br /&gt;
#Neurodevelopmental skills training&lt;br /&gt;
#Seating device design and fabrication&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.illcphilippines.com/ “Welcome to ILLC”].''Independent Living Learning Centre''.(Accessed on 23 May 2012)&lt;br /&gt;
*[http://www.illcphilippines.com/3a_ps.html “Program and Services”].''Independent Living Learning Centre''.(Accessed on 23 May 2012)&lt;br /&gt;
*[http://philippines.panpages.com/listings/ph37042 “Independent Living Learning Center”].''Panpages''.(Accessed on 23 May 2012)&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=469729&amp;amp;publicationSubCategoryId=442 “ILLC: Enabling special children to be extraordinary”].''philSTAR.com''.(Accessed on 23 May 2012)&lt;br /&gt;
*[http://specialeducatorinmanila.blogspot.com/2012/03/independent-living-learning-centre-illc.html “Independent Living Learning Centre (ILLC)”].''Special educator in Manila''.(Accessed on 23 May 2012)&lt;br /&gt;
&lt;br /&gt;
==External links==&lt;br /&gt;
*[http://www.illcphilippines.com/5map.html “ILLC Map”].''Independent Living Learning Centre''.(Accessed on 23 May 2012)&lt;br /&gt;
*[http://www.autismpinoy.com/doctors-and-schools/sped-schools.html “SPED schools”].''Welcome to Autism Pinoy''.(Accessed on 23 May 2012)&lt;br /&gt;
*Rivadelo, Genevieve.[http://www.mb.com.ph/node/327296/wanted-a- “Wanted: A school for kids with mild mental retardation”].''mb.com.ph''.(Accessed on 23 May 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
[[Category:Special Education Schools in the Philippines]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/d6dMBo3ZwxrRv7K03LMxLwhP9g4/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/d6dMBo3ZwxrRv7K03LMxLwhP9g4/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/d6dMBo3ZwxrRv7K03LMxLwhP9g4/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/d6dMBo3ZwxrRv7K03LMxLwhP9g4/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/VvqLdjVK_Ds" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 23 May 2012 09:29:28 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Independent_Living_Learning_Centre</comments>		</item>
		<item>
			<title>Norman Gonzales</title>
			<link>http://en.wikipilipinas.org/index.php?title=Norman_Gonzales</link>
			<description>&lt;p&gt;Summary: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Infobox NBA Player&lt;br /&gt;
|name =  Norman Gonzales&lt;br /&gt;
|nickname = &lt;br /&gt;
| image = &lt;br /&gt;
|league =  Asean Basketball League&lt;br /&gt;
|height_ft = 6 | height_in = 4 | weight_lbs=200&lt;br /&gt;
|team = [[San Miguel Beermen]]&lt;br /&gt;
|position = Small forward/Power forward&lt;br /&gt;
|birth_date =  21 May 1976&lt;br /&gt;
|birth_place = [[Pampanga]]&lt;br /&gt;
|death_date = &lt;br /&gt;
|death_place = &lt;br /&gt;
|college = [[San Beda College]]&lt;br /&gt;
|nationality = Filipino&lt;br /&gt;
|draft = 7&amp;lt;sup&amp;gt;rd&amp;lt;/sup&amp;gt; overall&lt;br /&gt;
|draft_team =  Mobiline Phone Pals&lt;br /&gt;
|draft_year = 2011&lt;br /&gt;
|former_teams = Powerade Tigers (2009-11) &amp;lt;br&amp;gt; [[Sta.Lucia Realtors]] (2004-2009) &amp;lt;br&amp;gt; [[Talk 'N Text Phone Pals]] (2001-2003) &lt;br /&gt;
|career_start = &lt;br /&gt;
|career_end =&lt;br /&gt;
|awards =&lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
'''Norman Gonzales''' (born 21 May 1976 in [[Pampanga]]) is a [[Filipino]] professional basketball player. He currently plays for the San Miguel Beermen in the Asean Basketball League (ABL). He was drafted the seventh overall in 2011 by the Mobiline Phone Pals.&lt;br /&gt;
&lt;br /&gt;
==Player profile==&lt;br /&gt;
Gonzales, with basketball jersey no. 28, began his basketball career for playing as a small forward or power forward for the [[San Beda College]].&lt;br /&gt;
&lt;br /&gt;
After entering ABL in 2001, he became its toughest sixth man. He was known for giving big points to the team. He produced double points in his amateur days playing in the now defunct MBA. &lt;br /&gt;
&lt;br /&gt;
Gonzales was also known as a good defensive stopper inside and outside. He spent two years playing for [[Talk 'N Text Phone Pals|Talk 'N Text]] before signing up as a free agent of [[Sta.Lucia Realtors|Sta. Lucia]].&lt;br /&gt;
&lt;br /&gt;
He was also signed as a free agent of [[Coca-Cola Tigers]], where he became one of their reliable role players, in August 2009.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.pba-online.net/profile/Norman-Gonzales/99/ “Norman Gonzales”].''PBA Online!''.(Accessed on 21 May 2012)&lt;br /&gt;
*[http://www.enotes.com/topic/Norman_Gonzales “Norman Gonzales”].''eNotes''.(Accessed on 21 May 2012)&lt;br /&gt;
*[http://www.aseanbasketballleague.com/stats/player/118 “Norman Gonzales”].''Air Asia ASEAN Basketball League''.(Accessed on 21 May 2012)&lt;br /&gt;
&lt;br /&gt;
==External links==&lt;br /&gt;
*[http://www.pba.ph/news/entry/1115 “Powerade Acquires More Fresh Talents”].''PBA News''.(Accessed on 21 May 2012)&lt;br /&gt;
*[http://twitter.com/#!/normG28 “Norman Gonzales on Twitter”].''twitter''.(Accessed on 21 May 2012)&lt;br /&gt;
&lt;br /&gt;
{{Philippines-stub}}&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category:Filipino Professional Basketball Players]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/iH8e2C1JuN7FMhiNAvKHV7J6TUg/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/iH8e2C1JuN7FMhiNAvKHV7J6TUg/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/iH8e2C1JuN7FMhiNAvKHV7J6TUg/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/iH8e2C1JuN7FMhiNAvKHV7J6TUg/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/UGPH9369aW4" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 21 May 2012 09:36:26 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Norman_Gonzales</comments>		</item>
		<item>
			<title>International Museum Day</title>
			<link>http://en.wikipilipinas.org/index.php?title=International_Museum_Day</link>
			<description>&lt;p&gt;Summary: New page: The '''International Museum Day''' is a yearly event aimed to raise awareness on how important museums are in the development of the society.  Since 1977, the International Museum Day is o...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The '''International Museum Day''' is a yearly event aimed to raise awareness on how important museums are in the development of the society.&lt;br /&gt;
&lt;br /&gt;
Since 1977, the International Museum Day is organized worldwide. The International Council of Museums (ICOM) Advisory Committee organizes the theme of the event. Participating countries ranges from America to Oceania including Africa, Europe and [[Asia]]. The event has been experiencing [http://icom.museum/what-we-do/activities/international-museum-day.html its highest involution with almost 30,000 museums that organised activities in more than 100 countries.] Event activities include talks from scientists, workshops and tours. &lt;br /&gt;
&lt;br /&gt;
IMD 2012 marks its 35th anniversary. With the theme “Museums in a Changing World. New Challenges, New Inspirations,” &amp;quot;IMD2012 is as much about museums growing and shaping their future, as it is about displaying and interpreting new issues like climate change, new media or social responsibility,&amp;quot; says ICOM on its official website.&lt;br /&gt;
&lt;br /&gt;
==2012 International Museum Day in the Philippines==&lt;br /&gt;
*The [[Ayala Museum]] in [[Makati]] offers free admission on May 18 in celebration of the event.&lt;br /&gt;
*The [[Mind Museum]] in [[Taguig]] offers a discounted rate of P500 for all-day passes. &lt;br /&gt;
*The [[Philippine Science Centrum]] in [[Marikina]] offers free admission for the first 200 visitors and  a P60 entrance (50% discount of the P120 original entrance pass) for the whole month.&lt;br /&gt;
*In [[Tuguegarao City]], museum workers will conduct a seminar and education tour at the Lyceum of Aparri Museum, Heritage Churches of [[Cagayan]], Piat Basilica Minore including the [[Cagayan]] Museum, and the [[Callao Caves]] Tourist Zone.&lt;br /&gt;
*The Kuliat Foundation Inc. of [[Tarlac City]] will host museum visits and lectures on &amp;quot;The Role of Museums in a New Society, Using the Past to Build the Future, New Media and Innovation.&amp;quot;&lt;br /&gt;
* With the theme “Gabii sa Kabilin,” [[Cebu City]] museums and heritage sites will open from 6 p.m. until midnight.&lt;br /&gt;
*An exhibit of World War II memorabilia collections will be held at the CNU Museum in [[Cebu]].&lt;br /&gt;
*A cooking demonstration of native delicacies of [[Mandaue]] will be held at the [[Mandaue City]] Central Plaza.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://icom.museum/what-we-do/activities/international-museum-day.html “International Museum Day”].''The World Museum Community''.(Accessed on 18 May 2012)&lt;br /&gt;
*Lapeña, Carmela G.[http://www.gmanetwork.com/news/story/258602/lifestyle/culture/filipinos-celebrate-international-museum-day-on-may-18 “Filipinos celebrate International Museum Day on May 18”].''GMA News Online''.(Accessed on 18 May 2012)&lt;br /&gt;
*[http://www.huffingtonpost.com/2012/05/17/international-museum-day-_n_1524828.html “International Museum Day 2012: Celebrate International Museum Day At Our Local Museums”].''Huff Post Los Angeles''.(Accessed on 18 May 2012)&lt;br /&gt;
&lt;br /&gt;
==External Links==&lt;br /&gt;
*[https://www.facebook.com/internationalmuseumday “International Museum Day- ICOM”].''facebook''.(Accessed on 18 May 2012)&lt;br /&gt;
*[http://www.boy-kuripot.com/2011/05/international-museum-day-11.html “International Museum Day '11”].''Philippine Freebies, Promos, Contests and More!''.(Accessed on 18 May 2012)&lt;br /&gt;
*[http://ph.news.yahoo.com/arts-agenda-international-museum-day-futureeverything-festival-art-200615323.html “Arts agenda: International Museum Day, FutureEverything Festival, Art HK”].''Yahoo! News''.(Accessed on 18 May 2012)&lt;br /&gt;
*[http://pinoyown.com/?p=64758  “Filipinos celebrate International Museum Day on May 18”].''newstheme''.(Accessed on 18 May 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
[[Category: Social Events]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/Db3Y3OYKm_k_kIX0oEGbegVLlOk/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Db3Y3OYKm_k_kIX0oEGbegVLlOk/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/Db3Y3OYKm_k_kIX0oEGbegVLlOk/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Db3Y3OYKm_k_kIX0oEGbegVLlOk/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/gwge9NbqlJo" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 18 May 2012 07:54:54 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:International_Museum_Day</comments>		</item>
		<item>
			<title>Jessica Sanchez</title>
			<link>http://en.wikipilipinas.org/index.php?title=Jessica_Sanchez</link>
			<description>&lt;p&gt;Summary: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Infobox musical artist &lt;br /&gt;
| Name                = Jessica Sanchez&lt;br /&gt;
| Img                   = Jessica.jpg&lt;br /&gt;
| Img_size           = 250px&lt;br /&gt;
| Background        = solo_singer&lt;br /&gt;
| Birth_name        =  &lt;br /&gt;
| Alias               = Jessica Sanchez&lt;br /&gt;
| Origin              = Chula Vista, California &lt;br /&gt;
| Born                = 4 August 1995&lt;br /&gt;
| Instrument          = Vocals&lt;br /&gt;
| Genre               = Hip Hop / R&amp;amp;B / Soul &lt;br /&gt;
| Occupation          = Singer&lt;br /&gt;
| Years_active        = 2006-present&lt;br /&gt;
| Label               = &lt;br /&gt;
| URL                 = [http://www.youtube.com/jsanchezfan  Official Jessica Sanchez on YouTube]&lt;br /&gt;
| notable role        = &lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
'''Jessica Sanchez''' (born 4 August 1995) is an American singer with Mexican and [[Filipino]] heritage. She is the runner-up of American Idol's (AI) eleventh season.&lt;br /&gt;
&lt;br /&gt;
==Early life==&lt;br /&gt;
Sanchez was born in Chula Vista, California. Her father Gilbert is from Mexico while her mother Editha is from [[Bataan]], [[Philippines]]. Because she was busy with music, she was homeschooled prior to trying out for AI. She took choir at Eastlake Middle School while in the eighth grade.&lt;br /&gt;
&lt;br /&gt;
==Rise to fame==&lt;br /&gt;
Sanchez has been singing since the age of 2 and sang in public by performing onstage on her 7th birthday. At the early age of 9, she earned two sit-down auditions with the A&amp;amp;R Department of Warner Bros. Records.&lt;br /&gt;
&lt;br /&gt;
She received her first standing ovation on television when she performed on the legendary music program ''Showtime at the Apollo'' when she was only 10 years old. Whoopi Goldberg, the Apollo host at the time, even called her back out on stage to accept a second round of applause.&lt;br /&gt;
&lt;br /&gt;
By age 11, the powerhouse singer amazed her audience by giving her own rendition of Celine Dion's “I Surrender” on ''America's Got Talent''. AGT judge and recording artist Brandy said, “You’re gonna be huge, I promise.” Simon Cowell, AGT producer and former AI judge, said that she was one of the best he's ever heard. Sanchez was eliminated in the semifinals.&lt;br /&gt;
&lt;br /&gt;
At age 13, Sanchez sang the American National Anthem before the Chargers' “Monday Night Football” game against the New York Jets in front of 68,922 people at Qualcomm Stadium. She admitted that she was nervous as it was her first time to sing in front of many people but she did a great job. She said that she hoped to get a record deal one day when asked on an interview after her performance. Her mother, who was in the audience at the time, said that she was very proud of Jessica. She was invited back in 2009 to sing the National Anthem when the Chargers fought the Miami Dolphins.&lt;br /&gt;
&lt;br /&gt;
She even had a stint in acting, when she starred in a nationally televised commercial campaign for Cricket Wireless. Producers said that they discovered her on YouTube. Her channel has already generated 22,000,000 views.&lt;br /&gt;
&lt;br /&gt;
Sanchez received her musical training as a scholar in the prestigious Theatre of Arts in Hollywood.&lt;br /&gt;
&lt;br /&gt;
==Awards and Recognition==&lt;br /&gt;
Sanchez has won many local singing competitions. In October 2009, She was selected by the Hepatitis B Foundation to participate in a three-city college campus music tour to help raise awareness about the medical condition.&lt;br /&gt;
&lt;br /&gt;
==''American Idol'' Overview==&lt;br /&gt;
Jessica auditioned for AI's eleventh season in her hometown of San Diego, California. Her group performance with Deandre Brackensick and Candice Glover of Buddy Holly's ''It Doesn't Matter Anymore'' received a standing ovation from AI's three judges.&lt;br /&gt;
&lt;br /&gt;
Sanchez has twice chosen Whitney Houston songs, a way too risky for any veteran AI contestant. She performed impressive renditions of “Bohemian Rhapsody” and Luther Vandross' “Dance With My Father”. AI judge Jennifer Lopez said that the latter was the most beautiful version she has ever heard. Steven Tyler even said &amp;quot;I don't think you could sing a song bad.&amp;quot; &lt;br /&gt;
&lt;br /&gt;
The judges chose to use their save on her when she landed on the bottom heap and faced elimination in the Top 7 week.  She is the first female finalist in AI history to receive the Judges' Save. &lt;br /&gt;
&lt;br /&gt;
As of April 2012, Sanchez already has 117,600 followers on Twitter. Even celebrities like AI finalists Adam Lambert and Jennifer Hudson, and TV talk show host Mario Lopez, a Chula Vista native, support her and hope she wins in the finals.&lt;br /&gt;
&lt;br /&gt;
Sanchez sang three songs in the semifinals: Mariah Carey’s “My All,” Aerosmith’s “I Don’t Wanna Miss A Thing,” and Jackson 5’s “I’ll Be There”. She was named one of the top two finalists. &lt;br /&gt;
&lt;br /&gt;
On 23 May 2012, Phillip Phillips bested Sanchez after a record-breaking total of 132 million votes. &lt;br /&gt;
&lt;br /&gt;
===Performances and results===&lt;br /&gt;
{|class=&amp;quot;wikitable&amp;quot; style=&amp;quot;text-align: center;&amp;quot;&lt;br /&gt;
!Episode&lt;br /&gt;
!Theme&lt;br /&gt;
!Song choice&lt;br /&gt;
!Original artist&lt;br /&gt;
!Order #&lt;br /&gt;
!Result&lt;br /&gt;
|-	&lt;br /&gt;
|Audition&lt;br /&gt;
|Auditioner's Choice&lt;br /&gt;
|&amp;quot;(You Make Me Feel Like) A Natural Woman&amp;quot;&lt;br /&gt;
|Aretha Franklin&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Hollywood Round, Part 1&lt;br /&gt;
|First Solo&lt;br /&gt;
|&amp;quot;Get Me Bodied&amp;quot;&lt;br /&gt;
|Beyoncé&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Hollywood Round, Part 2&lt;br /&gt;
|Group Performance&lt;br /&gt;
|colspan=2|Not aired&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Hollywood Round, Part 3&lt;br /&gt;
|Second Solo&lt;br /&gt;
|colspan=2|Not aired&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Las Vegas Round&lt;br /&gt;
|Songs from the Music history of the United States (1940s and 50s)&amp;lt;br /&amp;gt;Group Performance&lt;br /&gt;
|&amp;quot;It Doesn't Matter Anymore&amp;quot;&lt;br /&gt;
|Buddy Holly&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Final Judgment&lt;br /&gt;
|Final Solo &lt;br /&gt;
|&amp;quot;The Prayer'' (Celine Dion and Andrea Bocelli)&lt;br /&gt;
|Celine Dion &amp;amp; Andrea Bocelli&lt;br /&gt;
|N/A&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Top 25 (12 Women)&lt;br /&gt;
|Personal Choice&lt;br /&gt;
|&amp;quot;Love You I Do&amp;quot;&lt;br /&gt;
|Jennifer Hudson&lt;br /&gt;
|11&lt;br /&gt;
|Advanced&lt;br /&gt;
|-&lt;br /&gt;
|Top 13&lt;br /&gt;
|Whitney Houston&lt;br /&gt;
|&amp;quot;I Will Always Love You&amp;quot;&lt;br /&gt;
|Dolly Parton&amp;lt;!-- This section is for artists who sang the song FIRST - not the version which was covered. Dolly sang this first, not Whitney. --&amp;gt;&lt;br /&gt;
|12&lt;br /&gt;
|Safe&lt;br /&gt;
|-&lt;br /&gt;
|Top 11&lt;br /&gt;
|Year They Were Born&lt;br /&gt;
|&amp;quot;Turn the Beat Around&amp;quot;&lt;br /&gt;
|Vicki Sue Robinson&lt;br /&gt;
|2&lt;br /&gt;
|Safe&lt;br /&gt;
|-&lt;br /&gt;
|Top 10&lt;br /&gt;
|Billy Joel&lt;br /&gt;
|&amp;quot;Everybody Has a Dream&amp;quot;&lt;br /&gt;
|Billy Joel&lt;br /&gt;
|9&lt;br /&gt;
|Safe&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=2|Top 9&lt;br /&gt;
|rowspan=2|Their Personal Idols&lt;br /&gt;
|&amp;lt;small&amp;gt;Solo&amp;lt;/small&amp;gt; &amp;quot;Sweet Dreams&amp;quot;&lt;br /&gt;
|Beyoncé&lt;br /&gt;
|7&lt;br /&gt;
|rowspan=2|Safe&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Trio&amp;lt;/small&amp;gt; &amp;quot;Like a Prayer&amp;quot; / &amp;quot;Borderline&amp;quot; / &amp;quot;Express Yourself&amp;quot; &amp;lt;br/&amp;gt; with Hollie Cavanagh &amp;amp; Skylar Laine&lt;br /&gt;
|Madonna&lt;br /&gt;
|11&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=2|Top 8&lt;br /&gt;
|rowspan=2|Songs from the 1980s&lt;br /&gt;
|&amp;lt;small&amp;gt;Solo&amp;lt;/small&amp;gt; &amp;quot;How Will I Know&amp;quot; &lt;br /&gt;
|Whitney Houston&lt;br /&gt;
|7&lt;br /&gt;
|rowspan=2|Safe&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Duet&amp;lt;/small&amp;gt; &amp;quot;I Knew You Were Waiting (For Me)&amp;quot; &amp;lt;br/&amp;gt; with Joshua Ledet&lt;br /&gt;
|Aretha Franklin &amp;amp; George Michael&lt;br /&gt;
|10&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=2|Top 7&lt;br /&gt;
|rowspan=2|Songs from the 2010s&lt;br /&gt;
|&amp;lt;small&amp;gt;Solo&amp;lt;/small&amp;gt; ''Stuttering&amp;quot;&lt;br /&gt;
|Jazmine Sullivan&lt;br /&gt;
|4&lt;br /&gt;
|rowspan=2|Saved{{ref|1|1}}&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Trio&amp;lt;/small&amp;gt; &amp;quot;Stronger (What Doesn't Kill You)&amp;quot;&amp;lt;br/&amp;gt; with Hollie Cavanagh &amp;amp; Joshua Ledet&lt;br /&gt;
|Kelly Clarkson&lt;br /&gt;
|9&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=2|Top 7{{ref|2|2}}&lt;br /&gt;
|rowspan=2|Songs from Now &amp;amp; Then&lt;br /&gt;
|&amp;quot;Fallin'&amp;quot;&lt;br /&gt;
|Alicia Keys&lt;br /&gt;
|5&lt;br /&gt;
|rowspan=2|Safe&lt;br /&gt;
|-&lt;br /&gt;
|&amp;quot;Try a Little Tenderness&amp;quot;&lt;br /&gt;
|Ray Noble Orchestra&amp;lt;!-- This is the original artist; Otis Redding covered it. --&amp;gt;&lt;br /&gt;
|12&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=2|Top 6&lt;br /&gt;
|Queen&lt;br /&gt;
|&amp;quot;Bohemian Rhapsody&amp;quot;&lt;br /&gt;
|Queen&lt;br /&gt;
|1&lt;br /&gt;
|rowspan=2|Safe&lt;br /&gt;
|-&lt;br /&gt;
|Contestant's Choice&lt;br /&gt;
|&amp;quot;Dance with My Father&amp;quot;&lt;br /&gt;
|Luther Vandross&lt;br /&gt;
|7&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=3|Top 5&lt;br /&gt;
|rowspan=2|Songs from the 1960s&lt;br /&gt;
|&amp;lt;small&amp;gt;Solo&amp;lt;/small&amp;gt; &amp;quot;Proud Mary&amp;quot;&lt;br /&gt;
|Creedence Clearwater Revival&amp;lt;!-- Original artists; Ike &amp;amp; Tina Turner COVERED it. --&amp;gt;&lt;br /&gt;
|5&lt;br /&gt;
|rowspan=3|Safe&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Trio&amp;lt;/small&amp;gt; &amp;quot;(Your Love Keeps Lifting Me) Higher and Higher&amp;quot; &amp;lt;br/&amp;gt; with Hollie Cavanagh &amp;amp; Skylar Laine&lt;br /&gt;
|Jackie Wilson&lt;br /&gt;
|9&lt;br /&gt;
|-&lt;br /&gt;
|British pop music|British Pop&lt;br /&gt;
|&amp;quot;You Are So Beautiful&amp;quot;&lt;br /&gt;
|Billy Preston&amp;lt;!-- Check the Wiki page - Preston recorded his version before Joe Cocker did. --&amp;gt;&lt;br /&gt;
|11&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=4|Top 4&lt;br /&gt;
|rowspan=3|California Dreamin'&lt;br /&gt;
|&amp;lt;small&amp;gt;Solo&amp;lt;/small&amp;gt; &amp;quot;Steal Away&amp;quot;&lt;br /&gt;
|Jimmy Hughes &amp;lt;!-- Hughes sang this first; Etta covered it. --&amp;gt;&lt;br /&gt;
|4&lt;br /&gt;
|rowspan=4|Safe&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Duet&amp;lt;/small&amp;gt; &amp;quot;Eternal Flame&amp;quot;&amp;lt;br&amp;gt;with Hollie Cavanagh&lt;br /&gt;
|The Bangles&lt;br /&gt;
|6&lt;br /&gt;
|-&lt;br /&gt;
|&amp;lt;small&amp;gt;Quartet&amp;lt;/small&amp;gt; &amp;quot;Waiting for a Girl Like You&amp;quot;&amp;lt;br&amp;gt;with Hollie Cavanagh, Joshua Ledet &amp;amp; Phillip Phillips&lt;br /&gt;
|Foreigner&lt;br /&gt;
|7&lt;br /&gt;
|-&lt;br /&gt;
|Songs They Wish They'd Written&lt;br /&gt;
|&amp;quot;And I Am Telling You I'm Not Going&amp;quot;&lt;br /&gt;
|Jennifer Holliday&lt;br /&gt;
|11&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=3|Top 3&lt;br /&gt;
|Judges' Choice&lt;br /&gt;
|&amp;quot;My All&amp;quot;&lt;br /&gt;
|Mariah Carey&lt;br /&gt;
|2&lt;br /&gt;
|rowspan=3|Safe&lt;br /&gt;
|-&lt;br /&gt;
|Contestant's Choice&lt;br /&gt;
|&amp;quot;I Don't Want to Miss a Thing&amp;quot; &lt;br /&gt;
|Aerosmith&lt;br /&gt;
|5&lt;br /&gt;
|-&lt;br /&gt;
|Jimmy Iovine's Choice&lt;br /&gt;
|&amp;quot;I'll Be There&amp;quot;&lt;br /&gt;
|The Jackson 5&lt;br /&gt;
|8&lt;br /&gt;
|-&lt;br /&gt;
|rowspan=3|Finale&lt;br /&gt;
|Simon Fuller's Choice&lt;br /&gt;
|&amp;quot;I Have Nothing&amp;quot;&lt;br /&gt;
|Whitney Houston&lt;br /&gt;
|1&lt;br /&gt;
|rowspan=3|Runner-up&lt;br /&gt;
|-&lt;br /&gt;
|Favorite Performance&lt;br /&gt;
|&amp;quot;The Prayer&amp;quot;&lt;br /&gt;
|Celine Dion &amp;amp; Andrea Bocelli&lt;br /&gt;
|3&lt;br /&gt;
|-&lt;br /&gt;
|Winner's Single&lt;br /&gt;
|&amp;quot;Change Nothing&amp;quot;&lt;br /&gt;
|Jessica Sanchez&lt;br /&gt;
|5&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
==All-Out support from Filipinos==&lt;br /&gt;
[[Thia Megia]], a 16-year old Filipino-American singer and the youngest contestant in the history of AI to enter the Top 13, said that she and her family are supporting Sanchez. She said that she has already worked with Sanchez when she was 13.&lt;br /&gt;
&lt;br /&gt;
Deputy presidential spokesperson Abigail Valte said that [[Malacañang]] joins [[Filipino|Filipinos]] in hoping that Jessica will bag the title of American Idol. She said that they are wishing her the best of luck in the final stretch. Even Vice President [[Jejomar C. Binay]] called on [[Filipino|Filipinos]] around the world to continue supporting Sanchez. [[Jejomar C. Binay|Binay]] said that Sanchez makes the country proud by being vocal of her pride in her [[Filipino]] heritage.&lt;br /&gt;
&lt;br /&gt;
The [[Catholic Bishops' Conference of the Philippines]] (CBCP) urges [[Filipino|Filipinos]] to pray and vote for Sanchez. CBCP's executive sectary said that he is hoping that the youth will be inspired by her perseverance.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*McGrath,Jenny.[http://www.wetpaint.com/american-idol/articles/who-is-jessica-sanchez-american-idol-2012-contestant-background-info “Who is Jessica Sanchez? American Idol 2012 Contestant Background Info”].''Wetpaint American Idol''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.utsandiego.com/uniontrib/20080925/news_lz1sz25studen.html “Student Spotlight: Jessica Sanchez”].''San Diego Union-Tribune.''(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.gmanetwork.com/news/story/258096/pinoyabroad/pinoyachievers/malaca-hopes-jessica-sanchez-will-win-american-idol “Malacañang hopes Jessica Sanchez will win 'American Idol'”].''GMA News Online''.(Accessed on May 17, 2012)&lt;br /&gt;
*Chavez, Yong.[http://www.abs-cbnnews.com/entertainment/05/15/12/thia-gives-all-out-support-jessica-idol “Thia gives all-out support for Jessica on 'Idol'].''ABSCBNnews.com''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.abs-cbnnews.com/global-filipino/05/11/12/vp-binay-rallies-behind-jessica-sanchez “VP Binay rallies behind Jessica Sanchez”].''ABSCBNnews.com''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.gmanetwork.com/news/story/249284/showbiz/fil-mexican-jessica-sanchez-makes-it-to-a-i-s-top-24 “Fil-Mexican Jessica Sanchez makes it to A.I.'s top 24”].''GMA News Online''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.spinmoverecords.com/artists/jessica-sanchez/ “Jessica Sanchez”].''move''.(Accessed on May 17, 2012)&lt;br /&gt;
*Sampite, Allison K.[http://www.thestarnews.com/latest-news/tracking-jessica/ “Tracking Jessica”].''The Star News''.(Accessed on May 17, 2012)&lt;br /&gt;
*Anderson-Minshall, Diane.[http://realitytv.about.com/od/americanido1-alpha/tp/Idol-11-Top-5.htm “'American Idol' Finalists”].''About.com: Reality TV''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.abs-cbnnews.com/entertainment/05/09/12/cbcp-urges-pinoys-pray-vote-jessica-sanchez “CBCP urges Pinoys to pray, vote for Jessica Sanchez”].''ABSCBNnews.com''.(Accessed on May 17, 2012)&lt;br /&gt;
*Galarpe, Karen.[http://www.gmanetwork.com/news/story/258596/showbiz/showbizabroad/jessica-sanchez-makes-it-to-top-2-on-american-idol Jessica Sanchez makes it to top 2 on 'American Idol'].''GMA News Online''.(Accessed on May 18, 2012)&lt;br /&gt;
*Mateo, Janvic.[http://thepoc.net/breaking-news/entertainment/15909-jessica-sanchez-makes-it-to-american-idols-top-3.html “Jessica Sanchez makes it to American Idol's Top 3”].''Philippine Online Chronicles''.(Accessed on May 18, 2012)&lt;br /&gt;
*Mateo, Janvic.[http://thepoc.net/breaking-news/entertainment/15970-jessica-sanchez-to-face-phillips-in-idol-finale.html “Jessica Sanchez to face Phillips in 'Idol' finale”].''Philippine Online Chronicles''.(Accessed on May 18, 2012)&lt;br /&gt;
*[http://www.rappler.com/entertainment/5783-live-blog-american-idol-finale-performance-night “LIVE BLOG: 'American Idol' finale: Performance night”].''RAPPLER''.(Accessed on May 23, 2012)&lt;br /&gt;
*Ramos, NR.[http://www.mb.com.ph/articles/353646/idol-contender-jessica-sanchez-us-mags-top-pick “'Idol' contender Jessica Sanchez is US mags' top pick”].''mb.com.ph''.(Accessed on May 24, 2012)&lt;br /&gt;
*[http://abcnews.go.com/blogs/entertainment/2012/02/american-idol-judges-praise-unreal-costumed-group-performances-give-standing-ovation/ “‘American Idol’: Judges Praise ‘Unreal’ Costumed Group Performances, Give Standing Ovation”].''abc NEWS''.(Accessed on May 24, 2012)&lt;br /&gt;
*Olivier, Bobby.[http://www.nj.com/entertainment/tv/index.ssf/2012/05/american_idol_2012_winner_phil.html “'American Idol' 2012 winner: Phillip Phillips defeats Jessica Sanchez”].''nj.com''.(Accessed on May 24, 2012)&lt;br /&gt;
&lt;br /&gt;
==External Links==&lt;br /&gt;
*[http://www.myspace.com/jessicaesanchez “Official Jessica Sanchez”]. ''Jessica Sanchez on Myspace''.(Accessed on May 17, 2012)&lt;br /&gt;
*[http://www.youtube.com/jsanchezfan “Official Jessica Sanchez”]. ''Jessica Sanchez on YouTube''.(Accessed on May 17, 2012)&lt;br /&gt;
*[https://twitter.com/#!/JSanchezAI11 “Jessica Sanchez”].''Jessica Sanchez on Twitter''.(Accessed on May 17, 2012)&lt;br /&gt;
*[https://www.facebook.com/JSanchezAI11 “Jessica Sanchez”].''Jessica Sanchez on Facebook''.(Accessed on May 17, 2012)&lt;br /&gt;
*Wenger, Stephanie.[http://www.hollywood.com/news/American_Idol_Jessica_Sanchez_Backstage/23915969 “'American Idol': Inside the Dramatic Save”].''hollywood''.(Accessed on May 17, 2012)&lt;br /&gt;
*Ragaza, Jan Marcel.[http://thepoc.net/thepoc-features/sosyal/sosyal-features/15574-american-idol.html “Can Jessica Sanchez win American Idol?”].''Philippine Online Chronicles''.(Accessed on May 18, 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas Contents}}&lt;br /&gt;
&lt;br /&gt;
&amp;lt;noinclude&amp;gt;&lt;br /&gt;
{{DEFAULTSORT: Sanchez, Jessica}}&lt;br /&gt;
[[Category:Media and Entertainment|Sanchez, Jessica]]&lt;br /&gt;
[[Category:Philippine Singers|Sanchez, Jessica]]&lt;br /&gt;
[[Category:Philippine Women|Sanchez, Jessica]]&lt;br /&gt;
[[Category:Featured Articles for Main Page|Sanchez, Jessica]]&lt;br /&gt;
&amp;lt;/noinclude&amp;gt;&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/wL-8HRBSrjLpKfC9COZc6cJYasc/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/wL-8HRBSrjLpKfC9COZc6cJYasc/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/wL-8HRBSrjLpKfC9COZc6cJYasc/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/wL-8HRBSrjLpKfC9COZc6cJYasc/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/fpRroK8_oKM" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 17 May 2012 09:34:29 GMT</pubDate>			<dc:creator>Smoochies</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Jessica_Sanchez</comments>		</item>
		<item>
			<title>Press freedom in the Philippines</title>
			<link>http://en.wikipilipinas.org/index.php?title=Press_freedom_in_the_Philippines</link>
			<description>&lt;p&gt;Summary: New page: '''Press freedom''' is guaranteed in the [[Constitution of the Philippines]], where it is enshrined in Article III, Section 4.  Although the [[Philippines]] is said to have one of the free...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Press freedom''' is guaranteed in the [[Constitution of the Philippines]], where it is enshrined in Article III, Section 4.&lt;br /&gt;
&lt;br /&gt;
Although the [[Philippines]] is said to have one of the freest press in Asia, Philippine press and news media, from the campus, local, and national levels have suffered censorship, prosecution, intimidation, and attacks, particularly during [[Proclamation No. 1081|Martial Law]]. Currently, the Philippines is ranked 140th in the 2011 Reporters Withour Borders' Press Freedom Index and third in Committee to Protect Journalists' (CPJ) Press Freedom Index.&lt;br /&gt;
&lt;br /&gt;
==Spanish colonial rule==&lt;br /&gt;
Philippine press started with the establishment of the Spanish ''[[Del Superior Govierno]]'', known as the first newspaper published in the Philippines. Like subsequent newspapers published by Spaniards, ''Del Superior Govierno'' catered to the Philippine-based Spanish elite and reported about government affairs and religion.&lt;br /&gt;
&lt;br /&gt;
Nationalist newspapers critical to the Spanish regime were published in Europe, such as ''[[La Solidaridad]]'', or underground, such as the ''[[Kalayaan]]'' and ''La Independenca''. However, these newspapers were not legally and openly allowed to be circulated in the Philippines. Nonetheless, these newspapers contributed to the nationalist ferment and the expansion of the [[Philippine Revolution|Philippine revolution]] against Spanish rule.&lt;br /&gt;
&lt;br /&gt;
==American colonial rule==&lt;br /&gt;
The modern newspaper in the Philippines was pioneered by the American colonial regime. Two currently existing newspapers--''[[The Manila Times]]'' and the ''[[Manila Bulletin]]''--were established during this regime. Though the Americans introduced the concept of democracy and free press to the Philippines, their colonial regime was said to have suppressed nationalist papers such as ''El Nuevo Dia'', ''[[El Renacimiento]]'', and ''Sakdal''.&lt;br /&gt;
&lt;br /&gt;
==Japanese colonial rule==&lt;br /&gt;
The press, as well as radio, was suppressed and attacked during the Japanese occupation as all media were controlled by the Japanese imperial army. However, underground publications by anti-Japanese forces were disseminated.&lt;br /&gt;
&lt;br /&gt;
==Third Republic==&lt;br /&gt;
The years 1946 to 1972 was dubbed as the “Golden Age of Philippine Journalism” for it enjoyed freedom, which was guaranteed by the government. It also spawned a breed of scholarly writers such as [[Armando Malay]], [[Salvador P. Lopez]], [[Arsenio Lacson]], among many others. During that time, the press was viewed as the watchdog of the government, but mainstream media organizations then were owned by big corporations.&lt;br /&gt;
&lt;br /&gt;
==Martial Law==&lt;br /&gt;
Press freedom in the Philippines suffered its biggest blow a day after the proclamation of Martial Law by the late president [[Ferdinand Marcos]]. Marcos' first order on the first day of Martial Law was the immediate closure of all news organizations and on the next day, he ordered the arrest and interrogation of publishers, editors, journalists, and broadcasters identified to be critical against the government.  From 21 to 23 September 1972, publication of newspapers were suspended, and radio and television broadcasts went off air.&lt;br /&gt;
&lt;br /&gt;
On 25 September 1972, the Department of Public Information (DPI) censored all media organizations by virtue of order number one and two, which required all media outlets to seek clearance from the DPI before publishing or airing news and information. Some news organizations resumed operations on said date.&lt;br /&gt;
&lt;br /&gt;
From 1972 to 1981, the Marcos administration issued several decrees ordering the censorship of media and the prohibition of disseminating information that were deemed to undermine the government. Censorship did not only cover local and national media organizations, but international media as well. Campus-based publications, which were known for its radical practice of journalism. were likewise censored or padlocked by the government. During this period, the government formed media censorship organizations such as the Media Advisory Council, Philippine Council for Print Media, and the still existing [[Kapisanan ng mga Brodkaster ng Pilipinas]].&lt;br /&gt;
&lt;br /&gt;
Upon the lifting of Martial Law, Marcos abolished the censorship organizations it established, which started the return of free press. In a short span of time, a number of newspapers published articles critical of the government. These publications were dubbed as the “mosquito press” for they dug deep into the underbellies of the Marcos administration. &lt;br /&gt;
&lt;br /&gt;
The most significant expose after the lifting of Martial Law was the reportedly fake [[Marcos Medals|Marcos World War II medals]], which were published by ''We Forum''. The expose resulted in the government seizure of We Forum. A year later, the ''Philippine Times'' was likewise seized after it ran a story implicating high ranking government and military officials in the assassination of then senator [[Benigno Aquino, Jr.]]&lt;br /&gt;
&lt;br /&gt;
Though it is widely believed that thousands of Filipinos critical against the Marcos regime were summarily executed or assassinated, which may include a significant number of journalists, the [[National Press Club]] officially registered 19 journalists killed and one missing from 1976 to 1985. Meanwhile, the New York-based CPJ registered 12 Filipino journalists killed from 1984 to 1985.&lt;br /&gt;
&lt;br /&gt;
==Post EDSA==&lt;br /&gt;
===Aquino administration===&lt;br /&gt;
After the [[EDSA Revolution of 1986]] which toppled the Marcos regime, press freedom was restored and guaranteed under the 1987 Constitution. As such, Marcos-era laws that were meant to censor the media were repealed. &lt;br /&gt;
&lt;br /&gt;
However, during the administration of [[Corazon Aquino]], AM radio stations [[DZEC]] and DYLA were closed by the government for airing the side of military rebels during a coup attempt in December 1989. In October 1987, at the height of the first wave of coup attempts against the government, Aquino filed a libel case against journalists [[Luis Beltran]] and [[Max Soliven]] due to their report that Aquino allegedly hid under her bed during the coup. Beltran and Soliven were initially convicted but were later acquitted by the [[Philippine Court of Appeals|Court of Appeals]].&lt;br /&gt;
&lt;br /&gt;
===Ramos administration===&lt;br /&gt;
CPJ listed 12 journalists killed under the presidency of [[Fidel Ramos]]. Ten out of the 12 fatalities were killed in different parts of [[Mindanao]] while the other two—[[DZMM]]'s Alberto Berbon and ''[[People's Journal]] Tonight's'' Danny Hernandez—were killed in [[Metro Manila]].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===Estrada administration===&lt;br /&gt;
During the [[Joseph Estrada|Estrada]] administration, two newspapers—''The Manila Times'' and the ''[[Philippine Daily Inquirer]]''--ran controversial stories that exposed probable evidences of corruption and plunder in the government. In 9 March 1999, Estrada filed a libel suit against ''The Manila Times'' for its muckraking article on the anomalous P17 billion power contract between an Argentine firm and the [[National Power Corporation]] which led to the issuance of a public apology by the newspaper's publishers. Consequently, Estrada withdrew the libel suit but some members of the editorial board of  ''The Manila Times'' resigned and eventually, ''The Manila Times'' closed on 22 July 1999 but was re-opened five months later under the ownership of know Estrada ally [[Mark Jimenez]]. The newspaper was later sold to its current owner Dante Ang.&lt;br /&gt;
&lt;br /&gt;
Meanwhile, on 10 July 1999 the ''Philippine Daily Inquirer'' suffered a political blow when movie advertisers withdrew their advertisements from the broadsheet two days after Estrada met with them. Former [[Office of the Press Secretary|Press Secretary]] [[Rodolfo Reyes]] said that the ''Inquirer's'' “biased reporting” led to the withdrawal of movie ads.&lt;br /&gt;
&lt;br /&gt;
In January 2001, Estrada was ousted via the second EDSA uprising, which installed then vice-president [[Gloria Macapagal-Arroyo]]. The so-called [[EDSA Revolution of 2001|EDSA Dos]] received a blow-by-blow coverage by the national and foreign press, and it is said that the non-violent uprising was a result of several investigative articles that exposed alleged anomalies under the Estrada administration.&lt;br /&gt;
&lt;br /&gt;
CPJ tallied three radiomen killed under the Estrada administration. &lt;br /&gt;
&lt;br /&gt;
===Arroyo administration===&lt;br /&gt;
Under the Arroyo administration, cases of media killings and attacks suddenly increased in numbers, making the Philippines one of the most dangerous countries in the world for journalists under her term. During her nine-year regime, 85 journalists and two media workers were killed, which is considered as having the most media fatalities after Martial Law. &lt;br /&gt;
&lt;br /&gt;
Furthermore, a daily broadsheet--''[[The Daily Tribune]]''--was raided by the government a day after Arroyo proclaimed a [[2006 State of Emergency in the Philippines|State of National Emergency]] on 24 February 2006, at the height of anti-Arroyo rallies and the [[Philippine Marine Corps|Marine]] standoff in [[Camp Aguinaldo]]. Arroyo likewise said that the government was “monitoring” the press and that “subversive” commentaries and reports will be prohibited during that State of National Emergency. &lt;br /&gt;
&lt;br /&gt;
Also in 2006, First Gentleman [[Mike Arroyo]] filed ten libel suits against 45 journalists, which were later dismissed. Inquirer publisher Isagani Yambot and seven of his editors notably posted bail after being held at the Manila Police District Station 10 in [[Pandacan, Manila]]. &lt;br /&gt;
&lt;br /&gt;
On 29 November 2009, journalists and media workers covering the so-called [[Manila peninsula rebellion|Manila Peninsula Siege]], when military forces under the leadership of rebel soldier-turned-senator [[Antonio Trillanes IV]] took over the [[Manila Peninsula Hotel]] in protest of the Arroyo administration, were detained at Camp Bagong Diwa in [[Taguig]]. On 15 November 2011, the [[Supreme Court]] revived the class suit filed by the detained journalists against the arresting police officers during the stand-off.&lt;br /&gt;
&lt;br /&gt;
On 23 November 2009, 58 people, including 32 journalists and two media workers, were summarily executed in [[Ampatuan, Maguindanao]]. Dubbed as the [[Maguindanao Massacre]], which was allegedly perpetuated by prominent members of the [[Ampatuan Clan|Ampatuan political clan]] in [[Maguindanao]] to prevent the nomination of political rival and incumbent Maguindanao governor [[Esmael Mangudadatu]], is considered as the single deadliest attack against journalists in history.&lt;br /&gt;
&lt;br /&gt;
===Benigno Simeon Aquino III administration===&lt;br /&gt;
CPJ listed eight journalists killed under the current administration of [[Benigno Simeon Aquino III]]. The most prominent case of media killing is on DWAR anchor and anti-mining activist [[Gerry Ortega]], who was allegedly killed under the orders of former [[Palawan]] governor [[Joel T. Reyes]]. Reyes is currently in hiding and is facing murder raps in Palawan. &lt;br /&gt;
&lt;br /&gt;
Aquino meanwhile scored the media for its “inaccurate” and “unfair” reporting. On the 16th founding anniversary of the [[Philippine Press Institute]], Aquino admonished the [[Malacanang]] Press Corps to follow the principle of “getting it first, and getting it right” since inaccurate stories will affect the image of the country. &lt;br /&gt;
&lt;br /&gt;
 &lt;br /&gt;
==Campus press freedom in the Philippines==&lt;br /&gt;
In 1991, the Campus Journalism Act of 1991 (CJA) was enacted, which specified the rights and responsibilities of student journalists and publications. However, the law did not provide a penalty clause against offenders. Despite its existence, the [[Pamantasan ng Lungsod ng Maynila]] (PLM) administration under then president [[Benjamin Tayabas]] shut down PLM's student publication ''[[Ang Pamantasan]]'' in 1992 and 2004 and dismissed some of its editors and staff after the publication ran stories on probable evidence of corruption and malversation of funds under the Tayabas administration. A number of cases of student publications which were shut down were also reported after the enactment of CJA while censorship bodies still exist in a number of private schools in the Philippines.&lt;br /&gt;
&lt;br /&gt;
As of 2005, a significant number of campus publications in the Philippines were threatened to be closed. Wrote Lloyd A. Luna of the Network of Campus Journalists of the Philippines:&lt;br /&gt;
&lt;br /&gt;
''”· By the end of 2005, another 20-30% of the total existing publication today will be closed&lt;br /&gt;
· In all parts of the country, non-mandatory collection of publication fee may be implemented in more than 100 schools.&lt;br /&gt;
· In the [[National Capital Region]], 35-45% may still exist through advertisement revenues&lt;br /&gt;
· In Northern Luzon, roughly 10-20% may not be supported by the school administration; in the [[Visayas]], 15-25%; and in [[Mindanao]],, 20-30%”''&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==Freedom of Information and Right of Reply==&lt;br /&gt;
Aside from physical attacks and intimidation against journalists, the lack of a Freedom of Information law is seen by a number of media organizations and civil society groups as a hindrance in reporting the state of government funds, which is historically tainted with cases of corruption and plunder. &lt;br /&gt;
&lt;br /&gt;
On 4 June 2011, the [[14th Congress of the Philippines|14th Congress]] junked with finality the FOI Act, as then [[Speaker of the Philippine House of Representatives||House Speaker]] [[Prospero Nograles]] declared a lack of quorum in passing the law.&lt;br /&gt;
&lt;br /&gt;
The FOI Act, though endorsed by President Aquino as a priority bill, is still pending in the 15th Congress. However, versions of the FOI Act filed by representatives [[Rodolfo Antonino]] (4th District, [[Nueva Ecija]]) and [[Pedro Romualdo]] ([[Camiguin]]) contains the “Right of Reply” (ROR) clause, which mandates media organizations to provide an equal space for the reply of government officials on issues addressed on them. However, the [[Freedom Fund for Filipino Journalists]] (FFFJ) and the [[National Union of Journalists of the Philippines]] rejected the ROR clause in Antonino's and Romualdo's version of the FOI as it is deemed as a “contraint” to editorial freedom.&lt;br /&gt;
&lt;br /&gt;
FFFJ stated: ''“The right of reply is in the first place already part of the professional and ethical responsibilities of the press, whether in print, online or broadcast. It is inherent in the ethical imperative of fairness, which mandates the presentation of all sides in a controversy. The principal function of the Philippine Press Institute’s Press Council is in fact to guarantee the right of reply. If that right has not always been respected in practice by some journalists, it is not a justification for subjecting all media organizations to a constraint on their freedom simply because of the failings of a few. Enshrining in law the punishment of all for the errors of a few is not only unreasonable. It is also dangerous, since it would infringe on a freedom vital to the health of a democracy.”''&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.cmfr-phil.org/2007/09/01/back-to-the-past-a-timeline-of-press-freedom/ Back to the Past: A timeline of press freedom]. Center for Media Freedom and Responsibility. (Accessed on 24 April 2012)&lt;br /&gt;
*Tuazon, Ramon R. [http://www.ncca.gov.ph/about-culture-and-arts/articles-on-c-n-a/article.php?igm=3&amp;amp;i=221 The Print Media: A Tradition of Freedom]. National Commission for Culture and the Arts. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://www.cmfr-phil.org/2012/01/27/philippines-ranked-140th-in-press-freedom-index/ Philippines ranked 140th in Press Freedom Index]. Center for Media Freedom and Responsibility. (Accessed on 24 April 2012)&lt;br /&gt;
*Escote, Alixander Haban. [http://socyberty.com/history/a-history-of-broadcasting-in-the-philippines-from-world-war-ii-to-the-birth-of-philippine-television/ A History of Broadcasting in the Philippines From World War II to the Birth of Philippine Television]. Socyberty.com. (Accessed on 24 April 2012)&lt;br /&gt;
*Hisona, Harold. [http://www.phnewsnetwork.com/2011/06/headlines/557-maguindanao-massacre-ranks-philippines-3rd-in-media-killing.html Maguindanao Massacre Ranks Philippines 3rd in Media Killing]. Philippine News Network. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://opinion.inquirer.net/25031/media-killings-watch Editorial: Media killings watch]. Philippine Daily Inquirer. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://pcij.org/blog/2006/06/02/govt-inaction-on-media-killings-encourages-attacks Media killings: Gov't inaction 'encourages attacks']. The Philippine Center for Investigative Journalism Blog. (Accessed on 24 April 2012)&lt;br /&gt;
*Baldemor, Mindy. [http://www.thepoc.net/thepoc-features/politi-ko/politiko-opinions/14174-make-impunity-history.html Make Impunity History]. The Philippine Online Chronicles. (Accessed on 24 April 2012)&lt;br /&gt;
*Tan, Fidelis. [http://www.thepoc.net/breaking-news/breaking-stories/15715-ph-third-in-the-world-in-unsolved-journalist-killings.html PH third in the world in unsolved journalist killings]. The Philippine Online Chronicles. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://cpj.org/killed/asia/philippines/ 72 Journalists Killed in the Philippines since 1992]. Committee to Protect Journalists. (Accessed on 24 April 2010)&lt;br /&gt;
*Maguddayao, Merck. [http://pcij.org/blog/2010/06/04/nograles-buries-foi-act-for-lack-of-quorum Nograles buries FOI Act for 'lack of quorum']. The Philippine Center for Investigative Journalism Blog. (Accessed on 24 April 2012)&lt;br /&gt;
*Luna, Lloyd A. [http://lloydluna.tigblog.org/post/27113 Campus Journalism in the Philippines: Mind the Gap]. Network of Campus Journalists of the Philippines. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://www.manilatimes.net/index.php/news/top-stories/12196-sc-revives-medias-peninsula-siege-suit SC revives media's Peninsula siege suit]. The Manila Times. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://www.cmfr-phil.org/2012/04/19/attacking-press-freedom-while-enhancing-it/ Attacking press freedom while &amp;quot;enhancing&amp;quot; it]. Center for Media Freedom and Responsibility. (Accessed on 24 April 2012)&lt;br /&gt;
*[http://pcij.org/blog/2012/04/23/practice-balance-and-fairness-pnoy-tells-philippine-media Practise balance and fairness, Pnoy tells Philippine media]. The Philippie Center for Investigative Journalism. (Accessed on 24 April 2012)&lt;br /&gt;
*Avendano, Christine O. [http://newsinfo.inquirer.net/181435/aquino-slams-media-for-inaccurate-negative-reporting Aquino slams media for inaccurate, negative reporting]. Philippine Daily Inquirer. (Accessed on 24 April 2012)&lt;br /&gt;
&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
&lt;br /&gt;
[[Category:Philippine History]]&lt;br /&gt;
[[Category:Philippine Mass Media]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/gEqiRb48EJdAZQPCnVYZp7U31Kk/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/gEqiRb48EJdAZQPCnVYZp7U31Kk/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/gEqiRb48EJdAZQPCnVYZp7U31Kk/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/gEqiRb48EJdAZQPCnVYZp7U31Kk/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/_-TUonOJEsw" height="1" width="1"/&gt;</description>
			<pubDate>Tue, 24 Apr 2012 12:12:37 GMT</pubDate>			<dc:creator>Wikimercky</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Press_freedom_in_the_Philippines</comments>		</item>
		<item>
			<title>Glicerio Sua</title>
			<link>http://en.wikipilipinas.org/index.php?title=Glicerio_Sua</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Major General Glicerio Sua''' was the former Commanding General of the [[1st Infantry Division]] of the [[Philippine Army]]. He was the first member of his class to be promoted ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Major General Glicerio Sua''' was the former Commanding General of the [[1st Infantry Division]] of the [[Philippine Army]]. He was the first member of his class to be promoted to Brigadier General. He was the Commander of the Task Force Comet, when the group launched a mission to rescue Martin and Gracia Burnham and [[Deborah Yap]]. Sua is a member of the PMA Class of 1972. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
Sua obtained his Bachelors degree from the [[Philippine Military Academy]] and is a member of the PMA Class of 1972. He is the most senior member of his class and the first to be promoted to Brigadier General. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Sua is a member of the Army’s elite [[Scout Rangers]]. One of his major field accomplishments was the successful rescue of several schoolchildren kidnapped in [[Basilan]] in 2000. The schoolchildren were all rescued safely, though some of their teachers were already dead, tortured and executed by the [[Abu Sayyaf Group]].&lt;br /&gt;
&lt;br /&gt;
He served as the Deputy Commander of the 1ID (Tabak Division), before being appointed as its Commanding General after General [[Romeo Dominguez]] was removed in his alleged involvement at the incident in Lamaitan. He led the Task Force Comet working to free missionaries Martin and Gracia Burnham. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.pinoyexchange.com/forums/showthread.php?t=75853&amp;amp;page=3 Pinoy Exchange]&lt;br /&gt;
*[http://www.thefreelibrary.com/Letters+suggesting+$2+mil.+ransom+for+U.S.+hostages+'genuine'.-a084260323 Letters suggesting $2 mil. ransom for U.S. hostages 'genuine']&lt;br /&gt;
*[http://www.angelfire.com/journal2/nbondoc/hostage_crisis_in_basilan.htm The Hostage Crisis in Basilan]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Division Commanders]]&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1972]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/sK2VBsBv1CU4kIRoLk-EHbyGXyI/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/sK2VBsBv1CU4kIRoLk-EHbyGXyI/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/sK2VBsBv1CU4kIRoLk-EHbyGXyI/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/sK2VBsBv1CU4kIRoLk-EHbyGXyI/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/a9dm_qNUyQ4" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 15 Mar 2012 15:19:24 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Glicerio_Sua</comments>		</item>
		<item>
			<title>Alfonso Dagudag</title>
			<link>http://en.wikipilipinas.org/index.php?title=Alfonso_Dagudag</link>
			<description>&lt;p&gt;Summary: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Lieutenant General Alfonso Dagudag''' was the former Commanding General of the [[South Luzon Command]] (Solcom) of the [[Philippine Army]]. He also commanded the [[4th Infantry Division]] and [[8th Infantry Division]]. Upon retiring from military service, Dagudag was appointed by former President [[Gloria Macapagal Arroyo]] [[Department of Environment and Natural Resources]] Anti-Illegal Logging Task Force. Dagudag is a graduate of Siliman University. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Dagudag obtained his Bachelors degree from the Siliman University.&lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
While in active service, Dagudag once commanded the 14th Infantry Battalion of the 8th Infantry Division. From August 28, 1987 to March 1, 1990, he served as the Commanding General of the 8ID. He also served as the CG of the 4th Infantry Division. He also served as the Army’s Vice Commander. &lt;br /&gt;
&lt;br /&gt;
Before his retirement, he was appointed as the Commander of the [[South Luzon Command]] of the Philippine Army. He was promoted to Major General on February 2002 &lt;br /&gt;
&lt;br /&gt;
Dagudag also served as a Board Member for the AFP Housing Board. &lt;br /&gt;
==Post-military appointment==&lt;br /&gt;
On December 2004, former President Arroyo announced the formation of the DENR Anti-Illegal Logging Task Force and the appointment of retired Lieutenant General Alfonso Dagudag as head of the task force. The Task Force was named as Task Force Sagip Kalikasan. &lt;br /&gt;
&lt;br /&gt;
He was appointed because Dagudag is familiar with the Sierra Madre mountain range and other forest systems in the area and once belonged to the military's elite [[Scout Ranger]] Regiment.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=200817 New Southcom chief named]&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-1999/2000-05-24-afp-housing.html AFP Housing Program]&lt;br /&gt;
*[http://www.mb.com.ph/node/120560 Pampanga folk try to stop seizure of ‘hot narra lumber]&lt;br /&gt;
*[http://www.afrim.org.ph/Archives/2004/Phil%20Daily%20Inquirer/December/02/Forest%20rangers%20to%20be%20armed.txt Anti-illegal logging unit formed]&lt;br /&gt;
*[http://www.newsflash.org/2002/09/hl/hl016708.htm 20 Abus killed in offensive]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: South Luzon Command Commanders]]&lt;br /&gt;
[[Category: Division Commanders]]&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/2GBLiws4wja62H6FjA2lGvZknUU/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/2GBLiws4wja62H6FjA2lGvZknUU/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/2GBLiws4wja62H6FjA2lGvZknUU/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/2GBLiws4wja62H6FjA2lGvZknUU/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/-6oAugKHP-c" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 14 Mar 2012 15:55:20 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Alfonso_Dagudag</comments>		</item>
		<item>
			<title>Nemesio Sigaya</title>
			<link>http://en.wikipilipinas.org/index.php?title=Nemesio_Sigaya</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Major General Nemesio Sigaya''' was the former Commander of the Air Defense Command of the [[Philippine Air Force]]. He was promoted to Major General on February 2002. Sigaya is...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Major General Nemesio Sigaya''' was the former Commander of the Air Defense Command of the [[Philippine Air Force]]. He was promoted to Major General on February 2002. Sigaya is a graduate of the Philippine Air Force Flying School in 1970. Sigaya is also an amateur painter.  He was one of the 100 Outstanding Alumni awardees of the [[West Visayas State University]]. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Sigaya is a graduate of the Aviation Cadet Program Class 1970 from the Philippine Air Force Flying School. . He took up his Masters in National Security Administration at the [[National Defense College of the Philippines]].&lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Sigaya has the distinction of being one of the six Filipino pilots who were trained to fly the F-8H Crusader in Dallas, Texas, USA. He served as the Commander of the 530th CTW during the campaign against the [[Moro Islamic Liberation Front]] and [[Abu Sayyaf Group]]. His last designation was serving as the Commander of the Air Defense Command. &lt;br /&gt;
&lt;br /&gt;
Sigaya has flew T-33, F-86F Sabrejackets, and F-8H Crusaders. He was promoted to Major General on February 2002. &lt;br /&gt;
&lt;br /&gt;
==Fund raising contribution==&lt;br /&gt;
Sigaya is also an amateur painter. He held an exhibit of his water color paintings at the Philippine Air Force Museum, [[Villamor Air Base]] on January 2012. His paintings depict the participation as fighter pilots in the pacification campaign against the secessionist rebels in the 70’s. &lt;br /&gt;
&lt;br /&gt;
The funds that will be collected will be for the benefit of Basa Air Base Hospital, Fighter town, Basa Air Base, Florida blanca, [[Pampanga]].&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.medskul.com/forum/archive/index.php/t-1702.html WVSU honors 100 Outstanding Alumni of the Century]&lt;br /&gt;
*[http://pafcirca70s.blogspot.com/2012/01/appeal-and-invitation.html A fund raising campaign of Maj. Gen. Sigaya]&lt;br /&gt;
*[http://pafcirca70s.blogspot.com/view/classic?z A fund raising campaign of Maj. Gen. Sigaya]&lt;br /&gt;
*[http://webcache.googleusercontent.com/search?q=cache:iPUIxBYpubYJ:www.scribd.com/doc/2086640/25/The-Way-Ahead+&amp;amp;cd=5&amp;amp;hl=tl&amp;amp;ct=clnk&amp;amp;gl=ph The Way Ahead]&lt;br /&gt;
*[http://beatingtheodds.ph/govph/index2.php?option=com_content&amp;amp;do_pdf=1&amp;amp;id=15851 GMA Swears in new envoys, promoted generals]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Philippine Air Force Generals]]&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: Filipino painters]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/1dIF1HOFVmm1WkDZZClRapMPd6w/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/1dIF1HOFVmm1WkDZZClRapMPd6w/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/1dIF1HOFVmm1WkDZZClRapMPd6w/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/1dIF1HOFVmm1WkDZZClRapMPd6w/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/LRtDEvs3Qnk" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 14 Mar 2012 12:54:10 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Nemesio_Sigaya</comments>		</item>
		<item>
			<title>Ruben Domingo</title>
			<link>http://en.wikipilipinas.org/index.php?title=Ruben_Domingo</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Vice Admiral Ruben Domingo''' was the former Commander of the [[Armed Forces of the Philippines]] [[Western Command]] based in [[Puerto Prinsesa]]. Domingo also served as the Co...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Vice Admiral Ruben Domingo''' was the former Commander of the [[Armed Forces of the Philippines]] [[Western Command]] based in [[Puerto Prinsesa]]. Domingo also served as the Commander of the Philippine Fleet. He was promoted to Vice Admiral on 2002, and retired on February 14, 2006 upon reaching the mandatory retirement age of 56. He is a member of the [[Philippine Military Academy]] Class of 1971. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Domingo obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1971. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Domingo served the [[Philippine Navy]] for a total of 35 from the time he graduated from the PMA in 1971 until his retirement in 2006. His last assignments were serving as the Commander of the Western Command of the AFP; and Commander of the [[Philippine Fleet]]. Domingo received his third star and was promoted to Vice Admiral on February 2002. &lt;br /&gt;
&lt;br /&gt;
==Notable contributions==&lt;br /&gt;
&lt;br /&gt;
On December 1999, Domingo was appointed as the Commander of the Naval Education and Training Command. Because of the NETC’s notoriety of corruption, he immediately set into motion a reform program centered into the cleansing of the procurement system. This resulted in P5 million worth of savings, which were then used to improve other training facilities and equipment. All his purchases went through canvassing and bidding procedures of procurement set forth by existing laws and guidelines.&lt;br /&gt;
&lt;br /&gt;
Dominguez involved the Intelligence division to monitor the process and set up entrapment operations whenever necessary.&lt;br /&gt;
&lt;br /&gt;
==Awards and recognitions==&lt;br /&gt;
For his contributions to the Navy, Dominguez was awarded [[Distinguished Service Star]].&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.newsflash.org/2002/02/hl/hl015297.htm New Ambassadors sworn, generals promoted]&lt;br /&gt;
*[http://www.mb.com.ph/node/57802 5 top AFP officers named to key posts by Chief of Staff]&lt;br /&gt;
*[http://www.newsflash.org/2004/02/hl/hl103442.htm Palace warns coddlers of Faeldon]&lt;br /&gt;
*[http://pcij.org/HotSeat/trillanes3.html A study of corruption in the Philippine Navy]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: Philippine Navy Commanders]]&lt;br /&gt;
[[Category: Vice Admirals]]&lt;br /&gt;
[[Category: PMA Class of 1971]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/gODDcz9DbKCnt4cwG1aFO-KKH3U/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/gODDcz9DbKCnt4cwG1aFO-KKH3U/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/gODDcz9DbKCnt4cwG1aFO-KKH3U/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/gODDcz9DbKCnt4cwG1aFO-KKH3U/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/959g96iSWW4" height="1" width="1"/&gt;</description>
			<pubDate>Wed, 14 Mar 2012 11:42:49 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Ruben_Domingo</comments>		</item>
		<item>
			<title>Clyde Fernandez</title>
			<link>http://en.wikipilipinas.org/index.php?title=Clyde_Fernandez</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Deputy Director General Clyde Fernandez''' was the former [[Philippine National Police]] Deputy Director for Administration. He served as the Executive Director for Center for T...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Deputy Director General Clyde Fernandez''' was the former [[Philippine National Police]] Deputy Director for Administration. He served as the Executive Director for Center for Translational Crimes. Fernandez retired on April 1, 2003 and is a member of the [[Philippine Military Academy]] Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Fernandez obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Fernandez last assignments while in active service included serving as the Deputy Director for Administration and Executive Director of Center for Transnational Crimes. Upon retiring from service, Fernandez was the second-in-command of the PNP. At one point in his career, he also served as the Director for Intelligence. &lt;br /&gt;
&lt;br /&gt;
His last promotion to Deputy Director Generals, equivalent to a three-star rank in the armed forces, sparked some outrage since he was promoted a Director less than six months ago. Fernandez officially retired on April 1, 2003. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=157520 Mendoza defends promotions]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=154070&amp;amp;publicationSubCategoryId=63 PNP junior officers lambast general’s ‘early’ promotion]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=168421 7 sacked cops to get key posts, after all]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: PMA Class of 1970]]&lt;br /&gt;
[[Category: Philippine National Police personnel]]&lt;br /&gt;
[[Category: Deputy Director Generals]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/F9pluPZMInwhDHDiUH8yqD2p8Tg/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/F9pluPZMInwhDHDiUH8yqD2p8Tg/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/F9pluPZMInwhDHDiUH8yqD2p8Tg/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/F9pluPZMInwhDHDiUH8yqD2p8Tg/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/D570EL7gAVk" height="1" width="1"/&gt;</description>
			<pubDate>Tue, 13 Mar 2012 03:00:36 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Clyde_Fernandez</comments>		</item>
		<item>
			<title>Romeo Dominguez</title>
			<link>http://en.wikipilipinas.org/index.php?title=Romeo_Dominguez</link>
			<description>&lt;p&gt;Summary: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Lieutenant General Romeo Dominguez''' was the former Commanding General of the [[North Luzon Command]] of the [[Philippine Army]]. He also served as the Commanding General of the 8th Infantry Division and [[Task Force Comet]]. In 2001, Dominguez was accused by Fr. [[Cirilo Nacorda]] of conniving with the [[Abu Sayyaf]] members and distributing the ransom money. Dominguez has denied all allegations. He is a member of the [[Philippine Military Academy]] Class of 1971.&lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Dominguez is a member of the PMA Class of 1971. His classmates include Senators [[Panfilo Lacson]] and [[Gringo Honasan]]. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Dominguez served as the Commanding General of the [[1st Infantry Division]] and [[8th Infantry Division]] of the Philippine Army. He was then appointed to Command the North Luzon Command (Nolcom), where he subsequently earned his third start and was promoted to Lieutenant General. &lt;br /&gt;
&lt;br /&gt;
===Allegations on Abu Sayyaf connivance===&lt;br /&gt;
&lt;br /&gt;
In 2001, Lamaitan parish priest Fr. Cirilo Nacorda accused Dominguez of conniving with the Abu Sayyaf Group  (ASG) on the ransom money. He was also investigated on the escape of the ASG after they were supposedly corned in the Lamaitan hospital. Further controversy hounded Dominguez when former ASG hostage and American preacher Gracia Burnham, in her book In the Presence of My Enemies, detailed how an unnamed military general even demanded a 50 percent cut from the ransom being demanded by the bandits.&lt;br /&gt;
&lt;br /&gt;
On August 2003, Armed Forces Chief of Staff [[Narciso Abaya]], cleared Dominguez of any collusion with the ASG. Dominguez’s promotion to Major General was put on hold by the [[Commission on Appointments]] initially, but eventually confirmed his rank as Major General. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-2002/03-14-press-statement-maj-gen-dominguez.html Press statement of Maj. Gen. Dominguez]&lt;br /&gt;
*[http://www.bulatlat.com/archive1/028basilan.html House Hearing on AFP-Abu connivance elicits more questions than answers]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=132108  Gen. Dominguez, pinaiyak ng mga senador]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Division Commanders]]&lt;br /&gt;
[[Category: PMA Class of 1971]]&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: North Luzon Command Commanders]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/Hus7oQDPdfJbeIoY5SXB6onOdUo/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Hus7oQDPdfJbeIoY5SXB6onOdUo/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/Hus7oQDPdfJbeIoY5SXB6onOdUo/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/Hus7oQDPdfJbeIoY5SXB6onOdUo/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/vuhE3L1uTN0" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 12 Mar 2012 16:31:28 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Romeo_Dominguez</comments>		</item>
		<item>
			<title>ISRAEL, EDGARDO</title>
			<link>http://en.wikipilipinas.org/index.php?title=ISRAEL%2C_EDGARDO</link>
			<description>&lt;p&gt;Summary: [[ISRAEL, EDGARDO]] moved to [[Edgardo Israel]] over redirect&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Rear Admiral Edgardo Israel''' was the former Commander of the Civil Relations Service of the [[Armed Forces of the Philippines]] and previously the AFP Inspector General. He is a member of the [[Philippine Military Academy]] Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Israel obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
As a Commodore in the Philippine Navy, Israel was appointed as AFP Inspector General. He was then promoted to Major General on May 2003. &lt;br /&gt;
&lt;br /&gt;
On June 10, 2003, he was appointed as the Head of the Civil Relations Service of the AFP. During his term, the Command spearheaded advocacy campaign for the AFP and the duly - constituted government in order to neutralize the propaganda efforts of the misguided soldiers during the failed mutiny on July 27, 2003 popularly known as [[Oakwood Mutiny]].&lt;br /&gt;
&lt;br /&gt;
==Awards and recognitions==&lt;br /&gt;
&lt;br /&gt;
Israel is a recipient of the [[Distinguished Serviced Stars]]. He also received numerous medals and ribbons among them the Bintang Yudha Dharma Nararya from the President of Indonesia.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.myheritage.com/site-30251261/alisangco?popup=4%2C+9343645390#notificationPanelAnchor OFWs: Are they really our heroes?]&lt;br /&gt;
*[http://findarticles.com/p/news-articles/manila-bulletin/mi_7968/is_2003_August_3/corpus-named-afp-civil-relations/ai_n33524900/ Corpus named chief of AFP civil relations service]&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-2002/09-10-cabuay-assumes-new-military-post.html Cabuay assumes new military post]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1970]]&lt;br /&gt;
[[Category: Rear Admirals]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/3qWmdWIHrqm-dP0Y0ofdwDwxVu4/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/3qWmdWIHrqm-dP0Y0ofdwDwxVu4/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/3qWmdWIHrqm-dP0Y0ofdwDwxVu4/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/3qWmdWIHrqm-dP0Y0ofdwDwxVu4/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/MwepzGkk2fU" height="1" width="1"/&gt;</description>
			<pubDate>Mon, 12 Mar 2012 01:32:07 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:ISRAEL%2C_EDGARDO</comments>		</item>
		<item>
			<title>Ralph Flores</title>
			<link>http://en.wikipilipinas.org/index.php?title=Ralph_Flores</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Major General Ralph Flores''' was the former Commander of the Air Logistics and Support Command of the [[Philippine Air Force]]. In 2005, Flores was demoted to Colonel, and his ...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Major General Ralph Flores''' was the former Commander of the Air Logistics and Support Command of the [[Philippine Air Force]]. In 2005, Flores was demoted to Colonel, and his promotions to Brigadier General and Major General were revoked for null and void by reason of his ineligibility for said appointments on account of his age. In 2011, the Sandiganbayan division acquitted Flores and cleared him of all falsification charges due to insufficiency of evidence. Flores is a member of the [[Philippine Military Academy]] Class of 1971. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Flores obtained his Bachelors degree form the Philippine Military Academy and is a member of the PMA Class of 1971. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Flores last designation in active duty was serving as Commander of the Philippine Air Force Air Logistics and support command. He was promoted to Brigadier General on July 18, 2002; and to Major General on April 15, 2003. &lt;br /&gt;
&lt;br /&gt;
===Demotion to the rank of Colonel===&lt;br /&gt;
&lt;br /&gt;
On April 2005, his promotion to the ranks of Brigadier General and Major General were revoked	 and deemed null and void by reason of his ineligibility for said appointments on the account of his age. &lt;br /&gt;
&lt;br /&gt;
Flores allegedly falsified his birth certificate and declared that he was born on March 30, 1949, and not on 1946 as what his original birth date is. As such, Flores should have had retired on March 30, 2002 upon reaching the mandatory retirement age of 56.&lt;br /&gt;
&lt;br /&gt;
A fact-finding committee was created on order from former CSAFP Gen. [[Narciso L Abaya]] to investigate the said allegation. The committee was headed by Major General [[Raul Relano]] and the committee established the fact that indeed Flores was born in 1946 based on PMA cadet information sheet and baptismal certificate.&lt;br /&gt;
&lt;br /&gt;
He was ordered to return all compensation, allowances and benefits he received after his mandatory retirement; and all awards he received from that period were also withdrawn. &lt;br /&gt;
&lt;br /&gt;
===Acquittal===&lt;br /&gt;
&lt;br /&gt;
On April 2011, the Sandiganbayan, voting, 3-2, acquitted Flores of falsification charges due to insufficiency of evidence. The Sandiganbayan reasoned that five of the charges were invalid because the documents they were based on did not qualify as public documents as defined by law, which were: Flores’ personal and family background, summary of information, medical history, medical examination and dental health record.&lt;br /&gt;
&lt;br /&gt;
Of the four remaining charges, the court agreed that the annual income tax returns of the accused for 1999, 2000 and 2001 as well as his NBI clearance for 2003 were all public documents where he declared his birth year as 1949.&lt;br /&gt;
&lt;br /&gt;
The court thus, cleared Flores of any criminal liability noting that the disclosure of one’s date of birth or an erroneous statement about it does not affect the purpose for which said documents were issued.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-2003/05-18-arroyo-okays-promotion-of-74-senior-afp-officers.html Arroyo okays promotion of 74 senior AFP officers]&lt;br /&gt;
*[http://www.malaya.com.ph/apr15/news16.html Ex-PAF general acquitted on falsification raps]&lt;br /&gt;
*[http://www.gmanetwork.com/news/story/217804/news/nation/court-clears-ex-paf-general-of-falsification-charges Court clears ex-PAF general of falsification charges]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=273993 For falsifying age, AFP general demoted]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1971]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/qPp-M7ltNFKRU5f2Lauc-4eHglM/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/qPp-M7ltNFKRU5f2Lauc-4eHglM/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/qPp-M7ltNFKRU5f2Lauc-4eHglM/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/qPp-M7ltNFKRU5f2Lauc-4eHglM/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/tOo8z-7DCpk" height="1" width="1"/&gt;</description>
			<pubDate>Sun, 11 Mar 2012 13:52:48 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Ralph_Flores</comments>		</item>
		<item>
			<title>Delfin Lorenzana</title>
			<link>http://en.wikipilipinas.org/index.php?title=Delfin_Lorenzana</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Major General Delfin Lorenzana''' was the former Special Presidential Representative for Veterans Affairs/Head of the Office Veterans Affairs of the [[Philippine Embassay]] in W...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Major General Delfin Lorenzana''' was the former Special Presidential Representative for Veterans Affairs/Head of the Office Veterans Affairs of the [[Philippine Embassay]] in Washington DC. While still in active service, he served as the Defense Armed Forces Attache in the United States; and was instrumental in defending the [[Malacanang Palace]] when supporters of former President [[Joseph Estrada]] attempted to storm the place. He is amember of the [[Philippine Military Academy]] (PMA) Class of 1973. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Lorenzana obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1973. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Lorenzana was commissioned as a Second Lieutenant in the [[Philippine Army]] in 1973 after completing He has held command and staff positions both in the Philippine Army and at General Headquarters.  He has served as the Commander of the [[Scout Ranger]] Company, Scout Ranger Battalion Commander, Light Armor Brigade (now Light Armor Division) Commander and [[Army Special Operations Commander]].  &lt;br /&gt;
&lt;br /&gt;
He has held staff positions in a Brigade, at HQS Philippine Army, two Unified Commands and at the Joint Operations Center, General Headquarters, and AFP.  He also served as instructor of ranger tactics at the Scout Ranger School and infantry tactics at the Philippine Army Training Command.&lt;br /&gt;
&lt;br /&gt;
His last designation was serving as the Defense and Armed Forces Attache to the United States. As military attaché, he has been on top of negotiations for the delivery of 20 UH-1H helicopters by the United States. &lt;br /&gt;
&lt;br /&gt;
He received his second star for Major General on May 2003 at the Blair House, the United States’ official guest house for visiting dignitaries. &lt;br /&gt;
&lt;br /&gt;
==Post-military appointment==&lt;br /&gt;
&lt;br /&gt;
November 30, 2004, President Arroyo appointed Lorenzana as Special Presidential Representative for Veterans Affairs/Head of the Office of Veterans Affairs of the Philippine Embassy in Washington, DC. He played a key role in helping Filipino veterans win their demand for compensation from the US government for their wartime services. The Filipino veterans were granted a USD198-million US compensation to be paid individually in lump sums of from USD9,000 to USD15,000.&lt;br /&gt;
&lt;br /&gt;
On August 13, 2009, Lorenzana was sacked by President Arroyo which led to outrage by the Filipino World War II veterans. He was replaced by retired Brigadier General [[Victor Corpuz]]&lt;br /&gt;
&lt;br /&gt;
==Awards and recognitions==&lt;br /&gt;
For defending former President [[Gloria Macapagal Arroyo]] against the supporters of former President Estrada, when they stormed the Palace in 2001, he received the [[Philippine Legion of Honor]].&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.philstar.com/article.aspx?articleid=497264 Pinoy veterans in US outraged by dismissal of Office of Veteran Affairs head]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=207373 General in May siege promoted]&lt;br /&gt;
*[http://groups.yahoo.com/group/BALITA-USA/message/431 Maj. Gen. Lorenzana to Lead Filipino Veterans in Final Battle]&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-2003/05-18-arroyo-okays-promotion-of-74-senior-afp-officers.html Arroyo okays promotion of 74 senior AFP officers]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1973]] &lt;br /&gt;
[[Category: Philippine Defense Attache]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/9kGZR_lH73FFKEef1yBlIEqKA3w/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/9kGZR_lH73FFKEef1yBlIEqKA3w/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/9kGZR_lH73FFKEef1yBlIEqKA3w/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/9kGZR_lH73FFKEef1yBlIEqKA3w/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/vQhdj1o4oQ0" height="1" width="1"/&gt;</description>
			<pubDate>Sun, 11 Mar 2012 12:55:15 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Delfin_Lorenzana</comments>		</item>
		<item>
			<title>Cesar Garcia</title>
			<link>http://en.wikipilipinas.org/index.php?title=Cesar_Garcia</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Brigadier General Cesar Garcia''' is the current National Security Adviser of President [[Benigno Aquino III]]. He previously served as the Director-General of the [[National In...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Brigadier General Cesar Garcia''' is the current National Security Adviser of President [[Benigno Aquino III]]. He previously served as the Director-General of the [[National Intelligence Coordinating Agency]]. He is a member of the [[Philippine Military Academy]] Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Garcia obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
While still a Colonel in the [[Philippine Army]], Garcia served as the senior military assistant to the Secretary of the [[Department of National Defense]]. &lt;br /&gt;
&lt;br /&gt;
He also served as the Director-General of the National Intelligence Coordinating Agency and became former President Gloria Macapagal Arroyo’s longest-serving intelligence Chief. However, Garcia resigned due to health reasons. He was replaced by Retired General [[Pedro Cabuay]]. &lt;br /&gt;
&lt;br /&gt;
==Post-military appointments==&lt;br /&gt;
&lt;br /&gt;
On July 9, 2010, Garcia was appointed by President [[Benigno Aquino III]] as his National Security Adviser. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.manilastandardtoday.com/insideNews.htm?f=2010/july/9/news2.isx&amp;amp;d=2010/july/9 Palace bares more appointments]&lt;br /&gt;
*[http://www.gmanetwork.com/news/story/114979/news/nation/arroyo-names-new-intelligence-chief Arroyo names new intelligence chief]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1970]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/4zz4FF-5Lhb6xgA-W2ssT5FW-P0/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/4zz4FF-5Lhb6xgA-W2ssT5FW-P0/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/4zz4FF-5Lhb6xgA-W2ssT5FW-P0/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/4zz4FF-5Lhb6xgA-W2ssT5FW-P0/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/TQu-8RoJGXE" height="1" width="1"/&gt;</description>
			<pubDate>Sun, 11 Mar 2012 04:17:59 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Cesar_Garcia</comments>		</item>
		<item>
			<title>Trinonio Salazar</title>
			<link>http://en.wikipilipinas.org/index.php?title=Trinonio_Salazar</link>
			<description>&lt;p&gt;Summary: New page: '''Retired General Trifonio Salazar''' is the current Director-General of the [[National Intelligence Coordinating Agency]] and the former Commanding General of the [[1st Infantry Division...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired General Trifonio Salazar''' is the current Director-General of the [[National Intelligence Coordinating Agency]] and the former Commanding General of the [[1st Infantry Division]] (Tabak Division) of the [[Philippine Army]]. Salazar received his second star and was promoted to Major General on May 2003. He is a member of the [[Philippine Military Academy]] Class of 1974. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Salazar obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1974. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Salazar’s last assignment before retiring at the age of 56, the mandatory retirement age for military personnel, was commanding the 1ID of the Philippine Army. As Commander of Task Force Tabak, he campaigned against the [[Abu Sayyaf]] and the members of the Jema’ah Islamiyah terrorist network operating in [[Mindanao]], which led to killing of several [[Moro Islamic Liberation Font]] fighters. &lt;br /&gt;
He received his second and last star on May 2003. &lt;br /&gt;
&lt;br /&gt;
==Post-military appointments==&lt;br /&gt;
&lt;br /&gt;
Upon retiring from military service, former President [[Gloria Macapagal Arroyo]]  appointed him to serve as program manager of support services and environmental management of the [[Subic-Clark-Tarlac Expressway]]. &lt;br /&gt;
&lt;br /&gt;
On July 2010, President [[Benigno Aquino III]] appointed Salazar as the Director-General of the National Intelligence Coordinating Agency. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-2003/05-18-arroyo-okays-promotion-of-74-senior-afp-officers.html Arroyo okays promotion of 74 senior AFP officers]&lt;br /&gt;
*[http://www.manilastandardtoday.com/insideNews.htm?f=2010/july/9/news2.isx&amp;amp;d=2010/july/9 Palace bares more appointments]&lt;br /&gt;
*[http://www.philippinerevolution.net/statements/al-ghozi-pursuit-operations Al-Ghozi Pursuit Operations]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1974]]&lt;br /&gt;
[[Category: Division Commanders]]&lt;br /&gt;
[[Category: 1st Infantry Division]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/MoKxT6Evrkmqe9AraSVOPMhnahk/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/MoKxT6Evrkmqe9AraSVOPMhnahk/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/MoKxT6Evrkmqe9AraSVOPMhnahk/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/MoKxT6Evrkmqe9AraSVOPMhnahk/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/ymVeAcz_rNk" height="1" width="1"/&gt;</description>
			<pubDate>Sun, 11 Mar 2012 02:19:08 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Trinonio_Salazar</comments>		</item>
		<item>
			<title>Neon Abuen</title>
			<link>http://en.wikipilipinas.org/index.php?title=Neon_Abuen</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Major General Neon Abuen''' was the former Commandant of the [[Philippine Air Force]]. He retired on December 2004 upon reaching the mandatory retirement age of 56. He also serv...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Major General Neon Abuen''' was the former Commandant of the [[Philippine Air Force]]. He retired on December 2004 upon reaching the mandatory retirement age of 56. He also served as the Commanding Officer of the [[Armed Forces of the Philippines]] Command and General Staff College, which is only known as the GSC. Abuen is a member of the [[Philippine Military Academy]] Class of 1971. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Abuen obtained his Bachelors degree from the [[Philippine Military Academy]] and is a member of the PMA Class of 1971. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
While serving as a Colonel in the Air Force, Abuen was the Commanding Officer of the 505th Search and Rescue Group when it expanded into a major unit of the PAF, tasked to conduct air search and rescue operations in support of the AFP and civilian agencies. &lt;br /&gt;
&lt;br /&gt;
He also served as the Deputy Chief of Staff for reservist and retiree affairs, and from March 1, 2001 to December 15, 2001, as the Commanding Officer of the General Staff Course of the AFP. He was promoted to Brigadier General on 2001, and received his second star on May 18, 2003. His last assignment before retiring on December 2004 was serving as the PAF Commandant. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.peemayers.net/classcall_2004-11-03.htm Maharlikan Class Call Dated November 3, 2004]&lt;br /&gt;
*[http://findarticles.com/p/news-articles/manila-bulletin/mi_7968/is_2003_May_26/arroyo-leads-philippine-navy-105th/ai_n33476749/ Arroyo leads Philippine Navy 105th anniversary rites today]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=206336 14 new PAF generals named]&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Armed_Forces_of_the_Philippines_Command_and_General_Staff_College AFP Command and General Staff College]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1971]]&lt;br /&gt;
[[Category: Philippine Air Force]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/B-wNhFkiJLFPB4A-0GWWQ7Msurs/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/B-wNhFkiJLFPB4A-0GWWQ7Msurs/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/B-wNhFkiJLFPB4A-0GWWQ7Msurs/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/B-wNhFkiJLFPB4A-0GWWQ7Msurs/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/FelU6cMhWyo" height="1" width="1"/&gt;</description>
			<pubDate>Sat, 10 Mar 2012 16:12:32 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Neon_Abuen</comments>		</item>
		<item>
			<title>Samuel Bagasin</title>
			<link>http://en.wikipilipinas.org/index.php?title=Samuel_Bagasin</link>
			<description>&lt;p&gt;Summary: /* Post-military appointment */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired General Samuel Bagasin''' was the former [[Department of National Defense]] Undersecretary for Civil, Veterans and Reserve Affairs. He also served as the Commanding General of the Central Command of the [[Armed Forces of the Philippines]]. Bagasin is a member of the [[Philippine Military Academy]] (PMA) Class of 1973. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Bagasin obtained his Bachelors degree form the Philippine Military Academy and is a member of the PMA Class of 1973. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Bagasin has had held key positions in the Armed Forces of the Philippines Within the [[Philippine Army]], he served as Commanding General of the [[4th Infantry Division]] (4ID) and [[5th Infantry Division]] (5ID). He also served as the Deputy Chief of Staff for Operations sometime in 2003. &lt;br /&gt;
&lt;br /&gt;
Bagsin was supposed to be have been appointed as the Southcom Chief in 2005, prompting his parents to fly all the way from the United States to attend the rites. However, former President [[Gloria Macapagal Arroyo]], designated General [[Edilberto Adan]] as its Commander at the last minute. Few weeks later, and on September 20, 2005, Bagsin was appointed as the AFP Deputy Chief. &lt;br /&gt;
&lt;br /&gt;
Another year later, he was appointed as the Commanding General of the [[Central Command]], which he served until his retirement. Bagasin was promoted to Brigadier General on July 2001, to Major General on May 2003, and to Lieutenant General on September 15, 2005. &lt;br /&gt;
&lt;br /&gt;
==Post-military appointment==&lt;br /&gt;
President [[Benigno Aquino III]] appointed Bagasin as the Undersecretary Civil, Veterans and Reserve Affairs of the Department of National Defense. He resigned from his position March 2011, citing family considerations as his reason for his resignation. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://www.centcom.ph/lineage19.htm Central Command lineage]&lt;br /&gt;
*[http://www.newsflash.org/2004/02/ht/ht005464.htm Bagasin assumes post as AFP Deputy Chief]&lt;br /&gt;
*[http://afp-cmo.tripod.com/articles-2003/05-18-arroyo-okays-promotion-of-74-senior-afp-officers.html&lt;br /&gt;
*[http://www.tribuneonline.org/nation/20110324nat6.html Bagasin resigns as DND undersecretary&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1973]]&lt;br /&gt;
[[Category: Central Command Commanders]]&lt;br /&gt;
[[Category: Division Commanders]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/fVPhVGSAgnHJ3VWQ5quIlcReB4I/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/fVPhVGSAgnHJ3VWQ5quIlcReB4I/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/fVPhVGSAgnHJ3VWQ5quIlcReB4I/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/fVPhVGSAgnHJ3VWQ5quIlcReB4I/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/xnQak_GE-sY" height="1" width="1"/&gt;</description>
			<pubDate>Sat, 10 Mar 2012 15:31:03 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Samuel_Bagasin</comments>		</item>
		<item>
			<title>Glenn Rabonza</title>
			<link>http://en.wikipilipinas.org/index.php?title=Glenn_Rabonza</link>
			<description>&lt;p&gt;Summary: /* =Awards and recognitions */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Major General Glenn Rabonza''' was the former Commanding General of the 8th Infantry Division (8ID). He retired on January 12, 2005 upon reaching the mandatory retirement age of 56. In his retirement, Rabonza served as the Executive Director of the Office of Civil Defense, and Head of the National Disaster Coordinating Committee. Rabonza is a member of the Philippine Military Academy (PMA) Class of 1970, and is a recipient of the [[Distinguished Service Star]]. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Rabonza obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1970. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Rabonza has had key designations in the Armed Forces of the Philippines throughout his military career. He served as the Commander of the [[Presidential Security Group]] (PSG) from January 23, 2001 to January 18, 2002. Rabonza was then the PSG chief who helped repulse the May 1 riot that threatened Malacañang and former President [[Gloria Macapagal Arroyo]]. &lt;br /&gt;
&lt;br /&gt;
He was then appointed as the Deputy Chief of Staff for Civil-Military Opeartions (J7). He was supposed to be the Deputy Chief of Staff for Intelligence, but a tip about General Genoroso Senga prompted President Arroyo to swap the two. &lt;br /&gt;
&lt;br /&gt;
He then became the Division Commander of the 8th Infantry Division, serving as its Commanding General until January 5, 2004. &lt;br /&gt;
&lt;br /&gt;
==Post-military appointments==&lt;br /&gt;
&lt;br /&gt;
After his stint in the military, Rabonza was appointed as the Executive Director of the Office of the Civil Defense and as the Head of the National Disaster Coordinating Committee.&lt;br /&gt;
&lt;br /&gt;
==Awards and recognition==&lt;br /&gt;
&lt;br /&gt;
Rabonza was awarded the Distinguished Service Star and the Philippine Army Command Plaque for his outstanding and exemplary service as Division Commander of 8ID. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://webcache.googleusercontent.com/search?q=cache:http://www.samarnews.com/News_clips/news22.htm MGen. Rabonza relinquish 8ID Command]&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Presidential_Security_Group Presidential Security Group]&lt;br /&gt;
*[http://www.newsflash.org/2001/12/ht/ht002165.htm New Armed Forces Designations Barred]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1970]] &lt;br /&gt;
[[Category: Division Commanders]]&lt;br /&gt;
[[Category: PSG Commanders]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/rLfFAfDLsLqCTOmiIhAYgaQsCq8/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/rLfFAfDLsLqCTOmiIhAYgaQsCq8/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/rLfFAfDLsLqCTOmiIhAYgaQsCq8/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/rLfFAfDLsLqCTOmiIhAYgaQsCq8/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/bkRTx0lNYMw" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 09 Mar 2012 13:45:08 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Glenn_Rabonza</comments>		</item>
		<item>
			<title>Gerardo Layug</title>
			<link>http://en.wikipilipinas.org/index.php?title=Gerardo_Layug</link>
			<description>&lt;p&gt;Summary: New page: '''Brigadier General Gerardo Layug''' is the current Deputy Commander of the [[Western Mindanao Command]] (Westmincom) of the [[Philippine Army]], and also served as its Chief of Staff. Hi...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Brigadier General Gerardo Layug''' is the current Deputy Commander of the [[Western Mindanao Command]] (Westmincom) of the [[Philippine Army]], and also served as its Chief of Staff. His previous assignment was Commanding the 301st Infantry Brigade of the [[3rd Infantry Division]]. Layug is a member of the [[Philippine Military Academy]] Class of 1980. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Layug obtained his Bachelors degree from the Philippines Military Academy and is a member of the PMA Class of 1980. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
In the field, Layug served as the 301st Infantry Brigade of the 3rd Infantry Division (Spear Division). He also served as the Chief of Staff of the Western Mindanao Command and was then promoted to Deputy Commander. &lt;br /&gt;
&lt;br /&gt;
In 2003, Layug was deployed by the AFP as part of its Philippine Humanitarian Contingent in Iraq and was one of the Advance/Quartering Party and Liaison Officers. &lt;br /&gt;
&lt;br /&gt;
He received his first star and was promoted to Brigadier General on September 7, 2010. &lt;br /&gt;
&lt;br /&gt;
==Awards and recognitions=&lt;br /&gt;
&lt;br /&gt;
Layug was awarded Outstanding PMA Alumni, representing the Army Special Operations. &lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://bayanihan.org/2010/09/08/p-noy-swears-in-newly-promoted-generals/ P-Noy swears in newly promoted generals]&lt;br /&gt;
*[http://www.philippinepeacekeepers.ph/?args=Registry&amp;amp;kstr=Gerardo+Layug&amp;amp;mode=1 Colonel Gerardo T Layug]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=150690 Singapore general leads PMA honorees ]&lt;br /&gt;
*[http://newsinfo.inquirer.net/90995/paf-bomber-plane-crash-lands-in-zamboanga-pilots-slightly-injured PAF bomber plane crash-lands in Zamboanga; pilots slightly injured]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Class of 1980]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/ir0PllsGBSBaBHJQVKTbI3DFs-U/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ir0PllsGBSBaBHJQVKTbI3DFs-U/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/ir0PllsGBSBaBHJQVKTbI3DFs-U/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/ir0PllsGBSBaBHJQVKTbI3DFs-U/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/2kOcR6uaJSo" height="1" width="1"/&gt;</description>
			<pubDate>Fri, 09 Mar 2012 12:42:26 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Gerardo_Layug</comments>		</item>
		<item>
			<title>Leopoldo Maligalig</title>
			<link>http://en.wikipilipinas.org/index.php?title=Leopoldo_Maligalig</link>
			<description>&lt;p&gt;Summary: New page: '''Retired General Leopoldo Maligalig''' was the 51st and youngest Superintendent of the [[Philippine Military Academy]], his last designation before his retirement on November 15, 2008. A...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired General Leopoldo Maligalig''' was the 51st and youngest Superintendent of the [[Philippine Military Academy]], his last designation before his retirement on November 15, 2008. As an officer, he served as Battalion and Brigade Commander of different Infantry Divisions of the [[Philippine Army]]. He is a member of the PMA Class of 1976.&lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Maligalig obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1976. He also took up Public Affairs Officers Course at the Defense Information School (DINFOS) at Fort Harrison, Illinois, USA; and Command and Staff Course (CSC) at the Australian Army Command and Staff College on early 1997. While there, he also concurrently completed his Masters in Defense Studies at the University of Canberra.  &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Maligalig’s first assignment upon being commissioned as 2nd Lieutenant was serving as Platoon Leader of the 37th Infantry Battalion of the [[2nd Infantry Division]]. He joined the 11th Special Forces Company that he would later serve as Commanding Officer from late 1980 to Feb 25, 1986. He was appointed as the operations and training officer of the Army's Honor Guard Battalion that he had helped train and organized as the 62nd Infantry Battalion in Fort Magsaysay. &lt;br /&gt;
&lt;br /&gt;
He also joined the 402nd Infantry Brigade, 4ID in Agusan del Norte. He would have a very short stint as brigade operations officer as the Commanding General of the 4ID handpicked him to take over the command of the 53rd Infantry Battalion as officer-in-charge only a few weeks after getting his promotion to major. He also commanded of the 28th Infantry Battalion operating in the NPA-infested towns of [[Agusan del Sur]] and [[Surigao del Sur]].  &lt;br /&gt;
&lt;br /&gt;
For staff positions, Maligalig was assigned as Assistant Chief of Staff for Plans, G-5, and later to be a pioneer in the new office for Education and Training, G-8, of the Army. He also acted as the Commandant of the Combat Arms School (CAS), Training and Doctrine Command (TRADOC) at [[Fort Magsaysay]] in [[Nueva Ecija]]. In 1999, he was appointed as the Army's Assistant Chief of Staff for Education and Training, G-8. Two years later he was appointed as Brigade Commander of the 4th Infantry Division's 402nd Infantry Brigade in Prosperidad, Agusan del Sur.&lt;br /&gt;
&lt;br /&gt;
On Jannuary 2006, former President [[Gloria Macapagal Arroyo]] appointed Maligalig as the youngest Superintendent of the PMA, which he previously served as the Commandant of the PMA Cadet of Corps. He retired on November 15, 2008.  	&lt;br /&gt;
==References==&lt;br /&gt;
*[http://pmasite.weebly.com/superintendent.html PMA Superintendent Leopoldo Maligalig]&lt;br /&gt;
*[http://www.gmanetwork.com/news/story/140074/news/nation/former-arroyo-senior-military-aide-named-pma-superintendent Former Arroyo senior military aide named PMA superintendent]&lt;br /&gt;
*[http://www.philstar.com/Article.aspx?articleId=318861 RAM leader’s brod named PMA superintendent]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: PMA Superintendents]]&lt;br /&gt;
[[Category: PMA Class of 1976]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/nHZ25eDveBMIVW141owPuBJD_yk/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/nHZ25eDveBMIVW141owPuBJD_yk/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/nHZ25eDveBMIVW141owPuBJD_yk/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/nHZ25eDveBMIVW141owPuBJD_yk/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/J90Qr7Y7_w8" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 08 Mar 2012 14:43:59 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Leopoldo_Maligalig</comments>		</item>
		<item>
			<title>Ramon Espera</title>
			<link>http://en.wikipilipinas.org/index.php?title=Ramon_Espera</link>
			<description>&lt;p&gt;Summary: New page: '''Retired Rear Admiral Ramon Espera''' is the current Naval Sea Systems Command Chief of the [[Philippine Navy]]. He was formerly the Commandant of the [[Armed Forces of the Philippines]]...&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;'''Retired Rear Admiral Ramon Espera''' is the current Naval Sea Systems Command Chief of the [[Philippine Navy]]. He was formerly the Commandant of the [[Armed Forces of the Philippines]] Command and General Staff Course. Espera is a decorated Naval Officer and is a member of the [[Philippine Military Academy]] Class of 1977. &lt;br /&gt;
&lt;br /&gt;
==Education==&lt;br /&gt;
&lt;br /&gt;
Espera obtained his Bachelors degree from the Philippine Military Academy and is a member of the PMA Class of 1977. He had his Masters in National Security Strategy at the National Defense University, National War College, Washington D.C., USA&lt;br /&gt;
&lt;br /&gt;
==Trainings==&lt;br /&gt;
&lt;br /&gt;
Espera is also a graduate of Combat Information Center Course; Anti-Submarine Warfare Course; Comptrollership Course; Naval Intelligence Officers' Course; General Staff Course; Joint Command and General Staff Course. &lt;br /&gt;
&lt;br /&gt;
==Military profile==&lt;br /&gt;
&lt;br /&gt;
Upon graduating from PMA, Espera had had occupied significant positions in the AFP notable of which are as follows: Commanding Officer of various Philippine Navy vessels, the last of which is [[BRP Emilio Jacinto]] (PS-35); Commander of Task Force 61 and 80; and Deputy Commander of Naval Forces Western Mindanao and Southern Luzon. &lt;br /&gt;
&lt;br /&gt;
He commandeered Patrol Force and the Naval Forces West (Navforwest) and served as Acting Commander of Western Command. He performed dual tasks as the Commandant of the Armed Forces of the Philippines Command and General Staff College and as the Acting Commander of the Naval Sea Systems Command. He served as the Exercise Director of the 2010 [[RP-US Balikatan]] 2010. He was promoted to Rear Admiral on March 1, 2010.&lt;br /&gt;
&lt;br /&gt;
==Awards and recognitions==&lt;br /&gt;
&lt;br /&gt;
Espera is a recipient of different military awards, decorations and commendations in the AFP, foremost of which are the [[Distinguished Service Star]], Outstanding Achievement Medal, Military Merit Medals and Military Commendation Medals. &lt;br /&gt;
&lt;br /&gt;
He has also received various Letter of Appreciations and Commendations. More so, he is a beneficiary of the Navy's prestigious Command At Sea Badge given only to naval officers who satisfactorily completed their Command At Sea assignments.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
*[http://webcache.googleusercontent.com/search?q=cache:http://nssc.navy.mil.ph/radmespera.htm Rear Admiral Ramon Espera]&lt;br /&gt;
*[http://navyspeak.blogspot.com/2010/03/navys-new-admiral-reservists.html Navy’s New Admiral, Reservists]&lt;br /&gt;
*[http://www.marines.mil/unit/mcbjapan/Pages/2010/100326-balikatan.aspx#.T1ipE8DxoXs Balikatan 2010 ends with closing ceremony]&lt;br /&gt;
{{Wikipilipinas contents}}&lt;br /&gt;
[[Category: Filipino military personnel]]&lt;br /&gt;
[[Category: Philippine Navy Commanders]]&lt;br /&gt;
[[Category: PMA Class of 1977]]&lt;br /&gt;
[[Category: Rear Admirals]]&lt;/div&gt;
&lt;p&gt;&lt;a href="http://feedads.g.doubleclick.net/~a/8jLxi19WjOpSqndwJOU6S4BfU9w/0/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/8jLxi19WjOpSqndwJOU6S4BfU9w/0/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;br/&gt;
&lt;a href="http://feedads.g.doubleclick.net/~a/8jLxi19WjOpSqndwJOU6S4BfU9w/1/da"&gt;&lt;img src="http://feedads.g.doubleclick.net/~a/8jLxi19WjOpSqndwJOU6S4BfU9w/1/di" border="0" ismap="true"&gt;&lt;/img&gt;&lt;/a&gt;&lt;/p&gt;&lt;img src="http://feeds.feedburner.com/~r/WikipilipinasTheHipnFreePhilippineEncyclopedia-NewPagesen/~4/tXOC_dlGJqM" height="1" width="1"/&gt;</description>
			<pubDate>Thu, 08 Mar 2012 13:16:08 GMT</pubDate>			<dc:creator>Thewealthwarrior</dc:creator>			<comments>http://en.wikipilipinas.org/index.php?title=Talk:Ramon_Espera</comments>		</item>
	</channel>
</rss>

