Nosce te ipsum ut melior fiat…Tumblr (3.0; @newblogposts)https://newblogposts.tumblr.com/<img src="https://64.media.tumblr.com/7e68a455eb94a4099d72a166ab56210b/38fc15d7b2efe27d-7a/s500x750/9cb90052462a014adfaa0765c9cfe7604b536165.jpg"/><br/><br/><h2>Free Plant Spirit Healing Event: Heal & Connect with Nature (Emma Fitchett)</h2> <p></p><h2 class="" data-sourcepos="1:1-1:95">Unleash Your Inner Plant Whisperer: Discover the Power of Plant Spirit Healing (Free Event!)</h2> <p data-sourcepos="3:1-3:56">Have you ever felt a deep connection with nature? Intuited a plant’s wisdom? Plant spirit healing, an ancient practice, can unlock these abilities and more!</p> <p data-sourcepos="5:1-5:47">Join renowned plant spirit healer Emma Fitchett, MSc, for a FREE online event on <strong>Tuesday, May 14th at 5:30 PM Pacific</strong>. In this transformative 60-minute session, you’ll explore:</p> <ul data-sourcepos="7:1-7:123"> <li data-sourcepos="7:1-7:123"><strong>The magic of plant spirit initiation:</strong> Similar to a shaman’s journey, this practice fosters a profound connection with nature, leading to deeper healing and self-awareness.</li> <li data-sourcepos="8:1-8:157"><strong>Connecting with plant energy:</strong> Learn how to quiet your mind, align with a plant’s energy field, and sense its unique qualities through your fingertips.</li> <li data-sourcepos="9:1-9:127"><strong>Plant communication:</strong> Discover how plants, with their innate wisdom, can offer exactly the support you need in any moment.</li> <li data-sourcepos="10:1-10:151"><strong>Unveiling your divine nature:</strong> Working with plant spirits opens doors to unseen realms, awakening your intuition and facilitating personal growth.</li> <li data-sourcepos="11:1-12:0"><strong>Becoming a plant spirit healer:</strong> <a href="https://shiftnetwork.infusionsoft.com/go/spp/knowthyself" target="_blank" rel="noopener noreferrer">Explore how to collaborate with plants to help yourself and others</a>.</li> </ul> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/spp/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7471" title="Join Emma and experience the power of plant spirit healing firsthand as you step into a relationship with nature that is alive, communicative, and profoundly healing" src="http://selfimprove.co/wp-content/uploads/2024/05/Join-Emma-and-experience-the-power-of-plant-spirit-healing-firsthand-as-you-step-into-a-relationship-with-nature-that-is-alive-communicative-and-profoundly-healing-1024x597.jpg" alt="Discover the Power of Plant Spirit Healing! Free Event with Emma Fitchett! Learn to connect with plants, receive healing energy, & awaken your intuition. Register Now!" width="775" height="452"/></a></p> <p data-sourcepos="13:1-13:41">This event is perfect for anyone seeking:</p> <ul data-sourcepos="15:1-19:0"> <li data-sourcepos="15:1-15:33">A deeper connection with nature</li> <li data-sourcepos="16:1-16:39">Enhanced intuition and self-awareness</li> <li data-sourcepos="17:1-17:28">Natural healing techniques</li> <li data-sourcepos="18:1-19:0">Personal growth and spiritual exploration</li> </ul> <p data-sourcepos="20:1-20:124"><strong>Bonus!</strong> Register for the free event and receive a complimentary PDF guide on conducting your own plant spirit initiation.</p> <p style="text-align: center;" data-sourcepos="22:1-22:90"><a href="https://shiftnetwork.infusionsoft.com/go/spp/knowthyself" target="_blank" rel="noopener noreferrer"><strong>>> Ready to embark on this transformational journey? Register now!</strong> <<</a></p> <p data-sourcepos="24:1-24:139"><strong>P.S.</strong> Even the plants in your home and garden hold immense healing potential. Learn how to connect with them and tap into their wisdom!</p><br/> <p><a href="http://selfimprove.co/free-plant-spirit-healing-event-heal-connect-with-nature-emma-fitchett/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/750270400845561856https://newblogposts.tumblr.com/post/750270400845561856Sun, 12 May 2024 07:33:30 -0400ancient traditionchakrasdivine selfEmma Fitchettenergetic signatureenergy healingfinger chakrasintuitionmini chakrasmystical initiationnatural healingnature connectionpalm chackraspersonal growthplant communicationplant medicineplant spirit healingplants energy field readingquiet your mindself awarenessshamanshamanic healingaccess intuitionactivationAncient MedicineAncient TraditionsawakeningBioenergeticsBiofield<img src="https://64.media.tumblr.com/a4eeae543212ab27bf2535c3be464e84/535c831620779093-9d/s500x750/a227ee01aba9c626c7d845213409e5a6005ce8ea.jpg"/><br/><br/><h2>Simple & Powerful EFT Tapping Exercise Raising Brainwaves of Positive Emotions</h2> <p></p><h2><b>Discover how to align your mind with creating greater health, happiness & fulfilment using just simple tapping - emotional freedom technique.</b></h2> Science has proven that there’s a strong link between your mind and the world around you… <i>and</i> that you can <b>align your mind with creating greater health, happiness, fulfillment, and more.</b> As we navigate the uncertainties of life, now more than ever, this capacity to shift our thinking, boost our wellbeing, and manifest our desired future can be a powerful tool….  Yet, it can take some mental reframing to access this skill. Like many, you may be in dire need of a positivity boost, perhaps having recently experienced unexpected changes, loss, or a forced transition.  On Saturday, May 7, <b>Dawson Church, PhD, one of the most brilliant researchers at the leading edge of consciousness science</b>, will distill the results of hundreds of eye-opening studies into a powerful synthesis with groundbreaking implications for your health and life. <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/egmtm/knowthyself" target="_blank" rel="noopener noreferrer">You can register here for <b><i>Discover Mind-to-Matter Science: Train Your Brainwaves to Transform Your Health & Create Your Own Reality</i></b></a></h3> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/egmtm/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7460" title="Join Dawson Church to learn simple EFT tapping exercise to promote the brainwave frequency of positive emotions" src="http://selfimprove.co/wp-content/uploads/2024/05/Dawson-Church-EFT-tapping-exercise-to-promote-the-brainwave-frequency-of-positive-emotions-1024x597.jpg" alt="Join Dawson Church to learn simple EFT tapping exercise to promote the brainwave frequency of positive emotions" width="770" height="449"/></a></p> In this 60-minute mini-workshop, you’ll:  <ul> <li>Learn about the scientifically proven <i>mind-to-matter</i> perspective on how human consciousness affects the physical world</li> <li>Discover the power of positivity and <b>how to use </b><b><i>mental framing</i></b><b> to shift scarcity to abundance</b> and manifest other desired outcomes</li> <li>Explore how particular brainwaves <b>boost reparative cell productivity</b> and increase your overall cognitive ability — AND how to stimulate these body and mind boosters</li> <li>Discover EcoMeditation and how it can help you <b>decrease cortisol levels, heart rate, anxiety, and pain</b> AND increase beneficial brainwave activity, immunity, and happiness</li> <li><b>Experience the power of EFT (Emotional Freedom Techniques)</b> in a 10-minute exercise where you’ll focus on a current challenge or future fear and see how it diminishes when you access a beneficial brainwave frequency</li> </ul> Dawson has a knack for making leading-edge science accessible and practical, particularly for transforming our lives…  Whether he’s talking about cultivating the most uplifting brainwaves… or achieving optimal heart-brain coherence… or how your body can repair its own DNA… you <b>come away with a profound understanding and practical tools for meaningful change.</b> <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/egmtm/knowthyself" target="_blank" rel="noopener noreferrer">>> You can RSVP for free here <<</a></h3> In <i>Discover Mind-to-Matter Science: Train Your Brainwaves to Transform Your Health & Create Your Own Reality,</i> you’ll experience an EFT (Emotional Freedom Techniques) exercise for quickly releasing the chemical charge of negative thinking to promote the beneficial brainwave frequency of positive emotions. We hope you’re able to catch the event as scheduled. But if you register and miss it, you’ll <a href="https://shiftnetwork.infusionsoft.com/go/egmtm/knowthyself" target="_blank" rel="noopener noreferrer">receive a downloadable recording as soon as it’s available</a>.<br/> <p><a href="http://selfimprove.co/tapping-eft-exercise-to-promote-brainwave-frequency-of-positive-emotions/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/749800449874477056https://newblogposts.tumblr.com/post/749800449874477056Tue, 07 May 2024 03:03:50 -0400anxietybrainwavesdecrease cortisol levelsDr. Dawson ChurchEFT master lessonsEFT TappingEFT training courseemotional freedom techniqueenergy healingexercisefearfulfillmenthappinesshealing practicesHealthhealthy livingheart ratelearn EFTlearn tappingmanifestationmind-body sciencenegativitypositive emotionspositive thinkingstressTrainingachieve balanceachieve mind balanceachieve peaceacupressure<img src="https://64.media.tumblr.com/d40cc574e90548dddd3e250059aea2ae/7e924f42071289eb-f2/s500x750/9e87ce1f7df5514b8dcca77fae65439c45c04ca8.jpg"/><br/><br/><h2>Free Event: Energy Medicine Techniques for a Sharper Brain (Dr. Melanie Smith)</h2> <p></p><h2><b>Discover a holistic approach to brain health with energy medicine techniques.</b></h2> <h3>You may be surprised to hear that your brain already begins its aging process at the tender age of eight!</h3> With that in mind, doesn’t it make sense to do everything you can to protect, preserve, and enhance your cognitive function to ensure that you maintain healthy mental acuity well into your elder years? According to <b>advanced energy medicine practitioner Dr. Melanie Smith</b>, there are many things that can chip away at our brain health starting at a <i>very</i> young age — <i>even in utero! </i> And, if we don’t intentionally enhance our brain’s resilience, we can start losing memory, focus, and clarity — and possibly develop conditions like Alzheimer’s, dementia, Parkinson’s, MS, or even compromise our gut health and immunity. That’s why we’re excited to invite you to join Dr. Melanie in a free video event on <b>Tuesday, April 30, at 5:30pm Pacific</b>, in which you’ll discover that… … regardless of your stage of life and what’s happened in your personal world, there are many things you can do to <b>rejuvenate, restore, and sharpen healthy brain activity — </b><b><i>particularly energy medicine practices</i></b> — to counteract <i>and </i>prevent the often negative impact of an aging brain. You’ll learn important (and fascinating!) information about the chronology of brain development. For example, did you know that <b>we come into the world with </b><b><i>all </i></b><b>the brain cells we’re ever going to have</b>? Dr. Melanie will provide a variety of <b>self-care measures</b> you can take on your own to bring relief, while <b>supporting and enhancing your brain potential at any age</b>. <blockquote><a href="https://shiftnetwork.infusionsoft.com/go/ema/knowthyself" target="_blank" rel="noopener noreferrer">> You can register for <b><i>The Power of Energy Medicine for the Aging Brain: Learn 3 Techniques to Build Neuroplasticity, Detox Your Brain & Strengthen Your Vagus Nerve</i></b></a></blockquote> <a href="https://shiftnetwork.infusionsoft.com/go/ema/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7454" title="Feel The Power of Energy Medicine for the Aging Brain Learn 3 Techniques to Build Neuroplasticity, Detox Your Brain & Strengthen Your Vagus Nerve" src="http://selfimprove.co/wp-content/uploads/2024/04/The-Power-of-Energy-Medicine-for-the-Aging-Brain-Learn-3-Techniques-to-Build-Neuroplasticity-Detox-Your-Brain-Strengthen-Your-Vagus-Nerve-1024x597.jpg" alt="The Power of Energy Medicine for the Aging Brain Learn 3 Techniques to Build Neuroplasticity, Detox Your Brain & Strengthen Your Vagus Nerve" width="775" height="452"/></a> In this hopeful and healing hour-long workshop, you’ll discover:<b></b> <ul> <li><b>3 energy-healing techniques</b> to build neuroplasticity, detox your brain, open up new neural pathways, and calm your nervous system</li> </ul> <ul> <li><b>The chronology of brain development</b> and the importance of having a fully developed brain before the age of eight</li> <li><b>How synapses are “communication connectors,”</b> and the important role they play in developing brain neuroplasticity </li> <li>Why your early childhood and other <b>difficult circumstances may still be impacting you now</b></li> <li><b>The role of the vagus nerve, which manages your parasympathetic nervous system</b>, and how its development in early childhood can affect your gut health and cause anxiety, depression, ADD, ADHD, and so much more</li> <li>Ways that <b>exposure to poor nutrition, food additives, processed food, toxins, and EMFs</b> — especially in early childhood — can negatively impact your brain health even in your later years</li> </ul> You’ll walk away from this event understanding that it’s never too late to heal and enhance your brain by incorporating energy medicine practices into your everyday life.  <p style="text-align: center;"><strong><a href="https://shiftnetwork.infusionsoft.com/go/ema/knowthyself" target="_blank" rel="noopener noreferrer">>> You can RSVP for free here to watch live and/or get free recording and extra training <<</a></strong></p><br/> <p><a href="http://selfimprove.co/free-event-energy-medicine-techniques-for-a-sharper-brain-dr-melanie-smith/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/749103670279503872https://newblogposts.tumblr.com/post/749103670279503872Mon, 29 Apr 2024 10:28:49 -0400ADDADHDagingaging brainAlzheimeranxietybrain detoxbrain healthcognitive functiondementiadepressionEMFEnergy Medicinefood additivesgut healthhealingHealthhealthy brainhealthy livingMelanie Smithmemory lossnervous systemneuroplasticitynutritionparasympatheticParkinsonprocessed foodrejuvenaterestoreself-care<img src="https://64.media.tumblr.com/00ffc2da75ebbe232f699585cbf7af13/e31c623fef3f9aa4-55/s500x750/7dd9cacedb2110b456bb38db199890c029ba126b.jpg"/><br/><br/><h2>Free Qigong Event: Master Ancient Shaolin Practice for Inner Strength & Rejuvenation</h2> <p></p><h2><b>Learn the Qigong that Master Bodhidharma introduced to Shaolin monks.</b></h2> What if growing older didn’t have to mean a decline in health and vitality?  What if you could <b>tap into your inner power</b> with an ancient wisdom system that can protect your vital energy field, acting like biological armor that shields your immune system and rejuvenates your spirit? Register to join The Shift Network on Saturday, April 27, for a free online event with <b>Master Robert Peng, world-renowned Qigong teacher and healer,</b> as he introduces you to Four Cycles Qigong, a movement meditation rooted in Shaolin wisdom.  <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/sqg/knowthyself" target="_blank" rel="noopener noreferrer">>> Register here: Discover the 4 Cycles of Shaolin Qigong: Practice an Ancient Movement Meditation That Protects Your Strength, Resilience & Immunity.</a></h3> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/sqg/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7447" title="Discover the 4 Cycles of Shaolin Qigong: Practice an Ancient Movement Meditation That Protects Your Strength, Resilience & Immunity" src="http://selfimprove.co/wp-content/uploads/2024/04/Discover-the-4-Cycles-of-Shaolin-Qigong-Practice-an-Ancient-Movement-Meditation-That-Protects-Your-Strength-Resilience-Immunity-1024x597.jpg" alt="Discover the 4 Cycles of Shaolin Qigong: Practice an Ancient Movement Meditation That Protects Your Strength, Resilience & Immunity" width="777" height="453"/></a></p> Originally developed for warriors, Four Cycles Qigong offers a pathway for anyone seeking to cultivate life force, enhance health, and achieve mindful awareness.  <b>In this hour-long event, you’ll explore:</b> <ul> <li>The <b>4 Cycles Qigong’s first cycle</b>, “Supporting the Sky, Raising the Earth,” extending your energy upward and downward, establishing a strong foundational stance to improve posture and ease back pain</li> <li>How <b>Guardian Qi</b> helps protect your energy, strengthening your physical body like biological armor so you’re not injured as easily and shielding your immune system, which would normally decline with age </li> <li>The<b> practice of ripening the melon </b>to understand nourishing Qi, bringing awareness to your lower dantian</li> <li>A mantra to <b>repeat when you go to bed or rest</b> so you can practice Qigong even in your dreams, harnessing its profound tranquility and sense of peace</li> <li>What <b>“dantian” actually means</b>, and how to access your elixir field’s energy of vitality through your lower dantian</li> </ul> You’ll learn how Four Cycles Qigong is done with simple breathing and mudras as a moving meditation. This engages the entire body, enhancing circulation and flexibility, and promoting the smooth flow of Qi through the meridians. Legend has it that the great spiritual master Bodhidharma introduced the Four Cycles to Shaolin monks, rejuvenating their bodies and minds. <b>Now Robert brings you this ancient practice</b> that’s designed to strengthen your Guardian Qi and connect you with the essence of your being. <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/sqg/knowthyself" target="_blank" rel="noopener noreferrer">>> Register for free here to watch live.</a></h3> When you register for <i>Discover the 4 Cycles of Shaolin Qigong </i>with <b>master Robert Peng</b>, world-renowned Qigong teacher and healer<i>…</i> … you’ll move through the first form of 4 Cycles Qigong — “Supporting the Sky, Raising the Earth” — to improve posture and alleviate back pain as you extend your energy upward and downward. I hope you’ll <b>join the event as scheduled on Saturday, April 27</b>. But if you register and miss it, you’ll receive a recording soon after the event concludes. <a href="https://shiftnetwork.infusionsoft.com/go/sqg/knowthyself" target="_blank" rel="noopener noreferrer">Register for free right here</a>.<br/> <p><a href="http://selfimprove.co/free-qigong-event-master-ancient-shaolin-practice-for-inner-strength-rejuvenation/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/748837146972045312https://newblogposts.tumblr.com/post/748837146972045312Fri, 26 Apr 2024 11:52:33 -0400anti agingbiological armorcirculationdantianflexibilityGuardian Qigongimmune systeminternal strengthMaster Robert PengmeridianQigong meditationresilienceShaolin monksShaolin Qigongachieve balanceachieve mind balanceachieve peaceAncient MedicineAncient TraditionsAncient WisdomAnti-agingat homeBodyBreathingBuddhismChi energy flowChinesecoursesEmotionalEmotions<img src="https://64.media.tumblr.com/b796f47258b6e7bc40151d77b15a18b6/96f51114a03d68fa-08/s500x750/980843d8616f3ea4ceea969e8547b969de1260ca.jpg"/><br/><br/><h2>Free Breathwork Workshop: Master Prāṇāyāma for Health & Consciousness (Gary Kraftsow)</h2> <p><strong>Did you know that each breath you take holds the potential to transform something you’re struggling with?</strong> In fact, <b>master yoga teacher Gary Kraftsow</b> teaches that you can program your breath using ancient prāṇāyāma (the science of breath) techniques that not only empower your intention… … but <i>integrate all the dimensions of your being </i>— physiologically, psychologically, emotionally, and spiritually. </p><h3>Gary will share how this works this Thursday, April 25, during his online event, <a href="https://shiftnetwork.infusionsoft.com/go/esby/knowthyself" target="_blank" rel="noopener noreferrer"><i>Experience Sacred Breath: Ancient Techniques for Elevating Your Health & Consciousness From a Renowned Western Prāṇāyāma Master</i>…</a> </h3> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/esby/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7442" title="Join us for this Free Breathwork Workshop: Master Prāṇāyāma for Health & Consciousness (Gary Kraftsow)" src="http://selfimprove.co/wp-content/uploads/2024/04/Sacred-breathwork-to-elevate-your-health-consciousness-1024x597.jpg" alt="Free Breathwork Workshop: Master Prāṇāyāma for Health & Consciousness (Gary Kraftsow)" width="774" height="451"/></a></p> … where you’ll have the rare opportunity to explore the authentic teachings of prāṇāyāma — rare to find in the West today — to increase vitality, balance your emotions and nervous system, manage stress, overcome suffering, and cultivate the spiritual dimensions of life. The secrets of prāṇāyāma were once held in and transmitted through lineages — very few of which survived into modern times As a teenager, Gary was initiated into <i>prāṇāyāma</i> while studying in India with T.K.V. Deśikācar and his father, T. Kriṣṇamācāryaa, a renowned Yogi who brought the great tradition of authentic yoga to the West. He and his son served as a bridge between ancient and modern practice.  These traditional teachings illuminate <b>a multidimensional approach to breathwork</b> that creates conscious relationships with our body systems that are powered by intention. In this free online workshop, you’ll: <ul> <li><b>Gain a deeper understanding of the importance of breath</b> — and how you can work with it for health and wellbeing </li> <li><b>Be guided in an integration breathwork experience</b> on directional flow and expanding the threshold of the breath to support balanced sympathetic-parasympathetic regulation</li> <li>Learn about <b>the relationships between breathing, chanting, and meditating</b> — and the power of the breath to weave together these tools </li> <li>Begin to understand different ways to <b>control the flow of the breath to produce different effects</b></li> <li><b>Discover how to fully utilize the threshold breath</b> — a powerful, yet often misunderstood, secret of yoga — and why this is tremendously useful for your health and wellbeing </li> </ul> <b>For more than 50 years, Gary has been an innovator in the transmission of yoga</b> for health, healing, and personal transformation. He’ll share how the ancient and modern science of prāṇāyāma can create an integrated path of healing and awakening by <b>harnessing conscious intention to improve your health</b>… … <b>and supporting sympathetic-parasympathetic regulation</b> that helps you stabilize your health and unlock deeper layers of meaning, connection, and fulfillment. If this calls to you, I warmly invite you to join us this Thursday for Gary’s event on authentic prāṇāyāma — where you can begin to build a conscious relationship with the breath as <i>a powerful ally</i> to your health and spiritual evolution.  <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/esby/knowthyself" target="_blank" rel="noopener noreferrer">>> You can RSVP here to watch live event (or get recording)</a>. </h3><br/> <p><a href="http://selfimprove.co/free-breathwork-workshop-master-pra%e1%b9%87ayama-for-health-consciousness-gary-kraftsow/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/748588702580752384https://newblogposts.tumblr.com/post/748588702580752384Tue, 23 Apr 2024 18:03:38 -0400ancient yogaBalancebreath controlbreathingchantingconsciousemotionsGary KraftsowhealingHealthhealthy lifestylehealthy livingintentionmanage stressmeditatingmultidimensionalitynervous systemPranayamaspiritual developmentStress Managementwellbeingyogaachieve balanceachieve mind balanceAncient MedicineAncient TraditionsAnxietyat homeBodybreath<img src="https://64.media.tumblr.com/bdc58341f426721a58913e273b1c04de/f6912f957bfda253-9c/s500x750/012c3215f918599474562f1e690a07d3c8c6fb22.jpg"/><br/><br/><h2>Free Drumming Workshop: Relieve Stress & Awaken Chakras w/ Elemental Rhythms</h2> <p></p><h2><b>Join frame drummer Krista Holland for a FREE online Event & </b><b>Enliven your chakras & wellbeing with elemental drumming.</b></h2> <strong>Do you ever feel swept away by the stress, demands, and cadence of modern living?</strong> What if tuning in to your own pace, your own inner rhythm, was all you needed to regain your footing, reclaim equilibrium, and experience clarity and peace in the midst of chaos and uncertainty? A special event on Thursday, May 2, with <b>frame drummer Krista Holland</b>, founder of the Sacred Drumming Academy, offers a profound glimpse into the possibility drumming holds to transform the overwhelming areas of our lives into <i>pulsating presence</i>… … <strong>the grounding and uplifting rhythms that naturally arise within us when we’re attuned to our inner selves, as well as the deeper connections, meaning, and gifts that simply being alive affords us. <a href="https://shiftnetwork.infusionsoft.com/go/dcd/knowthyself" target="_blank" rel="noopener noreferrer">Register here to join us</a>.</strong> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/dcd/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7437" title="Join frame drummer Krista Holland for a FREE online event. Enliven your chakras & wellbeing with elemental drumming" src="http://selfimprove.co/wp-content/uploads/2024/04/Remedy-stress-with-elemental-drumming-through-the-chakras-1024x597.jpg" alt="A special event on Thursday, May 2, with frame drummer Krista Holland, founder of the Sacred Drumming Academy, offers a profound glimpse into the possibility drumming holds to transform the overwhelming areas of our lives into pulsating presence… " width="777" height="453"/></a></p> The Earth’s elemental energies permeate our bodies with the wisdom of time. <b>And every element has a rhythm</b>, Krista says, that holds the potential to balance us, reinvigorate us with aliveness, and reconnect us to the life-force energy that <i>animates all things</i>.  Chakras are the body’s primordial energetic reservoirs. Each elemental stroke on the drum also inspires its corresponding chakra to reverberate, sending waves of healing frequencies through you, and into every facet of your life.  Krista <i>has devoted more than 25 years</i> of research and practice to the frame drum and its ancient history — and infused it with ritual, myth, and ancient yogic and feminine drumming insights. <strong>If this resonates with you, I’d love for you to join us on Thursday, May 2, for Krista’s event. She’ll also guide us in a drumming chakra meditation to activate the power imagination holds to <a href="https://shiftnetwork.infusionsoft.com/go/dcd/knowthyself" target="_blank" rel="noopener noreferrer">dissolve stress and instill calm. You can RSVP here</a>.</strong><br/> <p><a href="http://selfimprove.co/remedy-stress-w-elemental-drumming-through-the-chakras/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/748279056934518784https://newblogposts.tumblr.com/post/748279056934518784Sat, 20 Apr 2024 08:01:57 -0400ancient artBalancechakra healingchakra meditationchakrasDeeper Connectionsdemandsdrum beatsdrummingdrumming meditationenergeticenergy healingfeminineframe drumminghealing frequenciesimaginationinner peaceKrista Hollandlifevforce energymeaningmythritualsound healingstressstress reliefvibrational healingwellbeingyogicaccess life forceAncient Traditions<img src="https://64.media.tumblr.com/3fcd954a51501c78ed0a6b956e331911/f045fee268ca9be9-bb/s500x750/f44f372432ac191c123efadd850543647098df85.jpg"/><br/><br/><h2>Heal Naturally: Free Event on Aligning with Nature for Vibrant Health</h2> <p></p><h2>Reset your Biorhythms by aligning with the Natural Forces of the Earth</h2> <strong>Do you crave a simpler, more conscious way of living and being in the world? </strong> A simpler lifestyle that’s in alignment with nature’s rhythms not only brings you greater joy and balance — but can inspire your body’s ability to reverse pain and chronic health conditions, says <b>osteopathic doctor Brian Siddhartha Ingle.</b> Join us <b>Saturday, April 13 for a free online event</b> <b>with </b>as Brian shares potent <b>bioharmonic practices </b>that have existed for millennia — and still have the power to realign us with the potent wisdom of nature’s laws, to recalibrate our systems for vibrancy, connectedness, and joy. <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/deys/knowthyself" target="_blank" rel="noopener noreferrer">>> Register here <<</a></h3> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/deys/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7427" title="Reset your biorhythms by aligning with the natural forces of the Earth" src="http://selfimprove.co/wp-content/uploads/2024/04/Reset-your-biorhythms-by-aligning-with-the-natural-forces-of-the-Earth-1024x597.jpg" alt="Heal Naturally: Free Event on Aligning with Nature for Vibrant Health" width="774" height="451"/></a></p> Known as a knowledgeable and compassionate teacher, Brian’s holistic approach to health weaves together embodied awareness, somatic movement, and osteopathic medicine to meet you where you are on your healing journey…  You’ll experience this firsthand as<b> Brian guides you in an embodied journey to create deeper potency in your field</b> and the inner foundation needed to experience natural law and <i>the health</i> in your system. You’ll discover how learning to live in alignment with nature and using its forces and rhythms — such as circadian and biorhythms, electromagnetism, light, and gravity — to harmonize your body systems, mind, and spirit is the basis of good natural hygiene and vibrant health. You’ll learn more about the pure detoxing power of natural hygienics, including how you can begin to harness the powerful and healing intelligence of nature’s laws to reset your biorhythms, detox your body, and optimize your health and wellbeing. <p style="text-align: center;"><strong><a href="https://shiftnetwork.infusionsoft.com/go/deys/knowthyself" target="_blank" rel="noopener noreferrer">>> I hope you’ll join us! RSVP here.</a></strong></p> In <i>Detox Your Energy System by Aligning to Nature’s Rhythm</i> with<b> osteopathic doctor Brian Siddhartha Ingle…</b> … you’ll inspire your body’s ability to reverse pain and chronic health conditions by realigning with the healing essence of nature and returning to a simple and joyful way of living and being. We hope you’ll join us as scheduled on Saturday, April 13 at 10:00am Pacific. But if you register and miss it, we’ll send you a recording soon after the event concludes. <a href="https://shiftnetwork.infusionsoft.com/go/deys/knowthyself" target="_blank" rel="noopener noreferrer">Register for free here</a>.<br/> <p><a href="http://selfimprove.co/reset-your-biorhythms-by-aligning-with-the-natural-forces-of-the-earth/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/747362815331958784https://newblogposts.tumblr.com/post/747362815331958784Wed, 10 Apr 2024 05:18:41 -0400bioharmonic practicesbiorhythmchronic paincircadian rhythmdetoxDr. Brian Ingleelectromagnetismnatural healingnatural hygienenature's rhythmsosteopathic medicineresetvibrant healthwellbeingBodyHealingHealth<img src="https://64.media.tumblr.com/6eb508fe424831355e4fd6401dfe2da0/ea7f7b98727cef3f-39/s500x750/e45f7eb70504e9593db004cb34c69ce70a78725f.jpg"/><br/><br/><h2>Free Event: Discover Your Supersensory Gift w/ an Ancestral Guide</h2> <p></p><h2>Unlock Your Ancestral Wisdom: Free Event on Discovering Your Supersensory Gift</h2> <p dir="ltr">Do you possess supersensory gifts — such as energy healing, medical intuition, any of the four clairs, mediumship, or the ability to access the Akashic records? </p> <p dir="ltr">Or perhaps you suspect you have such gifts but don’t know how to establish and use them.</p> <p dir="ltr">Join Afro-Indigenous medical intuitive and healer Dr. Jennifer Lisa Vest on Tuesday, April 9, for a brand-new event with The Shift Network with as she guides you to connect with an ancestor on a guided medicine journey.</p> <h3 dir="ltr" style="text-align: center;"><strong><a href="https://shiftnetwork.infusionsoft.com/go/ymig/knowthyself" target="_blank" rel="noopener noreferrer">>> Register here: Your Most Important Supersensory Gift: Connect With an Ancestor to Tap Into Your Psychic Gift & Align It With Your Life’s Purpose</a></strong></h3> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/ymig/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7421" title="Unlock Your Ancestral Wisdom - Free Event on Discovering Your Supersensory Gift" src="http://selfimprove.co/wp-content/uploads/2024/04/Unlock-Your-Ancestral-Wisdom-Free-Event-on-Discovering-Your-Supersensory-Gift-1024x597.jpg" alt="Unlock Your Ancestral Wisdom - Free Event on Discovering Your Supersensory Gift" width="777" height="453"/></a></p> <p dir="ltr">Your ancestor will unveil one of your supersensory gifts and explain how you can harness its full potential to support your soul’s evolution as you serve others.</p> <p dir="ltr">In this hour-long free online event, you’ll explore:</p> <ul> <li dir="ltr"> <p dir="ltr">A guided medicine journey to meet with an ancestor who’ll reveal (or remind you of) the most important supersensory gift you incarnated with — and explain how you’re meant to use it in this lifetime for your own soul growth </p> </li> <li dir="ltr"> <p dir="ltr">Specific ways to further develop your gift so you serve the greater good and help others</p> </li> <li dir="ltr"> <p dir="ltr">How this gift or gifts you were born with are connected to gifts you’re meant to develop going forward, so you can align with your purpose for this incarnation</p> </li> <li dir="ltr"> <p dir="ltr">How certain practices and habits, including meditation, can sharpen your spiritual gifts and expand your consciousness</p> </li> <li dir="ltr"> <p dir="ltr">An overview of your soul’s journey — including pre-incarnation, post-incarnation, life purpose, karma, and soul lessons — so you can better understand where your newly uncovered spiritual gift fits into your journey</p> </li> </ul> <p dir="ltr">You’ll learn how to feel more connected to — and empowered by — your intuitive gifts as you explore them through an Indigenous framework. </p> <h3 dir="ltr" style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/ymig/knowthyself" target="_blank" rel="noopener noreferrer">I hope you’ll join us! >> RSVP right here <<</a></h3> <p dir="ltr">When you join us for Your Most Important Supersensory Gift with Afro-Indigenous medical intuitive and healer Dr. Jennifer Lisa Vest…</p> <p dir="ltr">… you’ll connect with an ancestor and identify or confirm one of the supersensory gifts you were born with — and take a huge step toward understanding the reason your soul incarnated at this time.</p> <p dir="ltr">We hope you’ll join the event as scheduled on Tuesday, April 9. But if you register and miss it, <a href="https://shiftnetwork.infusionsoft.com/go/ymig/knowthyself" target="_blank" rel="noopener noreferrer">we’ll send you a recording soon after the event concludes. Register for free here! <<</a></p><br/> <p><a href="http://selfimprove.co/free-event-discover-your-supersensory-gift-w-an-ancestral-guide/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/747097969731452928https://newblogposts.tumblr.com/post/747097969731452928Sun, 07 Apr 2024 07:09:04 -0400Akashic Recordsancestral connectionconsciousnessguided meditationhealingincarnationIndigenousintuitionIntuitivekarmalife purposemeditationpsychic abilitiespsychic developmentsoul growthsoul lessonssoul purposespiritualsupersensory giftsactivationAfricaAncestralAncestral HealingAncient MedicineAncient TraditionsAncient WisdomAuthentic Selfbe happyclear karma<img src="https://64.media.tumblr.com/1094ded3ed0a222181d37384cd0c5c22/d233112bc7152622-75/s500x750/7e050c0905f50ca155519fd569d9350ddf6793d5.jpg"/><br/><br/><h2>Unlock Healing & Higher Consciousness with Sound Vibrations</h2> <p></p><h2><b>Explore the healing power of sound & vibration.</b></h2> The universe is in constant motion — <i>everything</i> is vibrating. The whole universe can be thought of as music, says <b>sound-healing scholar and researcher David Gibson</b>. In fact, your own body is both a set of vibrational frequencies and a frame for holding sound, which responds to specific healing frequencies and vibrations. When you discover how vibration works, you’re empowered to use sound for <b>healing the stuck emotional energy in your system</b>. Join David on <b>Tuesday, April 2 for a special event with The Shift Network, </b>as he provides a glimpse into his <b>insights, techniques, and practices </b>for accessing the full range of healing vibrations. <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/tvhc/knowthyself" target="_blank" rel="noopener noreferrer">You can register here for the free online event: <i>The Vibration of Healing & Consciousness: How Frequencies, Sounds, Music & Intention Transform Your Body, Emotions & Brainwaves <<</i></a></h3> <p style="text-align: center;"><img class="aligncenter wp-image-7416" title="Watch How sound healing can help you discover the specific frequencies and timbres of each chakra — and raise your energy body vibration" src="http://selfimprove.co/wp-content/uploads/2024/04/How-specific-frequencies-transform-your-body-emotions-brainwaves-1024x597.jpg" alt="How sound healing can help you discover the specific frequencies and timbres of each chakra — and raise your energy body vibration" width="770" height="449"/></p> In this illuminating event, you’ll discover: <ul> <li>A powerful practice to embrace <i>all </i>the frequencies within you to help you <b>access higher consciousness</b> — which David also refers to as Source or God</li> <li>How frequencies, sounds, music, and intention can <b>release stuck emotions and</b> <b>significantly transform your life </b>— physically, mentally, emotionally, and spiritually</li> </ul> <ul> <li>How sound healing can help you discover the <b>specific frequencies and timbres of each chakra</b> — and raise your energy body vibration</li> <li>How <b>binaural beats </b>activate specific systems within your brain, promoting heightened wellbeing as well as<b> relaxation, positivity, and improved memory</b> </li> </ul> <ul> <li><b>Experience the powerful frequency of Source itself — </b>and sense the bliss of being at one with the Universe</li> <li>How the <b>entire physical body is made up of different frequencies</b> —and how to tap into them as you work with your voice and instruments</li> </ul> You can learn which specific sounds help <i>you</i> reach <b>a sense of peace</b>… open your heart so you can <b>transform emotional issues as they arise</b>… and even explore the realms of higher consciousness by reaching a <i>theta</i> brain state. <h3 style="text-align: center;">I hope you’ll join us! <a href="https://shiftnetwork.infusionsoft.com/go/tvhc/knowthyself" target="_blank" rel="noopener noreferrer">>> You can RSVP right here <<</a></h3> In <i>The Vibration of Healing & Consciousness: How Frequencies, Sounds, Music & Intention Transform Your Body, Emotions & Brainwaves</i> with <b>David Gibson</b>… … you’ll experience the power of sound and vibration, and uncover the healing frequency you need most right now — to reduce pain, calm anxiety, heal disease, and raise your consciousness. I hope you’re able to catch the event as scheduled on <b>Tuesday, April 2.</b> But if you register and miss it, you’ll <a href="https://shiftnetwork.infusionsoft.com/go/tvhc/knowthyself" target="_blank" rel="noopener noreferrer">receive a recording soon after the event concludes. Register here <<</a><br/> <p><a href="http://selfimprove.co/how-specific-frequencies-transform-your-body-emotions-brainwaves/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/746589477625102337https://newblogposts.tumblr.com/post/746589477625102337Mon, 01 Apr 2024 16:26:48 -0400anxiety reliefbinaural beatsbinaural beats benefitsbrainwaveschakrachakra healing frequenciesconsciousnessDavid Gibsonemotional healingemotionsfree eventfrequencieshealinghealing soundpain reliefraise consciousnessreduce painsoundsound healingsound therapysound vibrationstherapytheta brainwave statetransformationachieve balanceBrainwaveChakraChakrasConsciousnesscourses<img src="https://64.media.tumblr.com/a7063e66be0bb44a1aeb23296cd33a62/83f72c9d4b6402ff-73/s500x750/d691e853d4458d836a7573b4c9d65d5485ada69f.jpg"/><br/><br/><h2>Unleash Your Inner Powerhouse of Love: Nordic Secret to Divine Connection</h2> <p></p><h2><b>Expand your capacity for love through an uncluttered connection to Source.</b></h2> If you’re like many people who are striving to get closer to the all-loving power of the force you may call God, Source, or Spirit, you may be disillusioned by some of the dogma of our conventional religions that imply you’re not already whole…  … especially after trying for a lifetime to become more spiritual, more enlightened, and better equipped to manifest your best life. What if God wasn’t a figure outside yourself who casts judgments and punishment and rewards you when you’re “good” — like you may have been raised to believe…  … but is <b>simply the luminous pulse of unconditional love, REAL love, that lives in the center of your own being and fills you with a sense of delight and joy</b>? According to Danish-born spiritual mentor and author Anja Steensig, <b>the mystical Nordic approach to spirituality is the simplest way she knows of connecting with the Divine</b>… … because it strips away all the excess layers of what the modern mind has created God to represent, and eliminates the obstacles in the way of simply <i>surrendering</i> to the essence of love, the big love within your own heart.  Join Anja in a free video event, where she’ll remind you of your true nature — of the love that you ARE — so you may <b>enter into more loving relationships with the Divine, yourself, and others, and become an imprint of love in the world</b>. <i>This </i>is the Nordic path, in which there’s no spiritual hierarchy, ideas, thought systems, or religious tenets that impose commands about who you should be and how you’re supposed to live.  <b>It’s a path into the truth that you and everything around you are infused with and radiate God’s essence.</b> <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/tnm/knowthyself" target="_blank" rel="noopener noreferrer">You can register here for <b><i>Discover the Path of the Nordic Mystic: Enter Into a Direct Connection to the Divine by Accessing the Pure Love in Your Heart <<</i></b></a></h3> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/tnm/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7410" title="Discover the Path of the Nordic Mystic: Enter Into a Direct Connection to the Divine by Accessing the Pure Love in Your Heart" src="http://selfimprove.co/wp-content/uploads/2024/03/The-Nordic-path-to-a-direct-uncluttered-connection-to-God-1024x597.jpg" alt="Discover the Path of the Nordic Mystic: Enter Into a Direct Connection to the Divine by Accessing the Pure Love in Your Heart" width="777" height="453"/></a></p> <b>During this heart-opening hour-long session with a true mystic, you’ll:</b> <ul> <li><b>Better understand the true nature of love</b> and how stripping away any excess layers brings you closer to Source</li> <li><b>Be guided through a meditation to truly experience the power of your all-loving soul</b>, enabling you to grasp your immense capacity for love, strength, and fearlessness</li> <li>Realize the importance of integrating the feminine and masculine aspects of love so you can be held in its fullness and <b>cultivate balanced relationships with yourself and others</b> </li> <li>Let go of the misconception that love is soft, submissive, and sweet, so you can <b>give yourself permission to rise above your eagerness to please and become a truly loving person</b></li> <li>Learn that when you make room for and express your justified anger — what Anja calls your “sacred wrath” — you can <b>experience profound healing</b></li> </ul> This event will help you feel empowered — knowing that you don’t have to search and seek outside yourself because<b> you’re already </b><b><i>everything </i></b><b>you need to be an incredible resource of love and wisdom</b> — with compassion for yourself and others, and the understanding that we’re all the same.  <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/tnm/knowthyself" target="_blank" rel="noopener noreferrer">>> You can RSVP for free here >></a></h3><br/> <p><a href="http://selfimprove.co/unleash-your-inner-powerhouse-of-love-nordic-secret-to-divine-connection/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/746001798598459392https://newblogposts.tumblr.com/post/746001798598459392Tue, 26 Mar 2024 04:45:44 -0400Anja Steensigdivine connectionfeminineGodhealingLovemasculinemeditationNordic spiritualityRelationshipssacred wrathself lovesourcespiritualityExpertGuidedHealingHeartMeditationMysticMysticalSelf Loveself-discoveryself-healing tools<img src="https://64.media.tumblr.com/637c63d81fb9bac673995cecb4837690/ba91ae4d6d0849b2-b2/s500x750/4aa7f3b510a3e529885bf0eaf99ca211a05197c4.jpg"/><br/><br/><h2>Discover the Wonder of Your Voice as a Spiritual Practice</h2> <p></p><h2><b>Discover the shamanic, contemplative, embodied & artistic aspects of your voice.</b></h2> Imagine <b>your voice as a bridge</b> to the deepest parts of yourself — a place where you don’t need formal training to sing, but an openness to the profound wisdom of the nurturing “Mother voice” within. <b>Artistic Director at The Vox Mundi School of Sound and the Voice Silvia Nakkach </b>approaches working with the voice in an unconventional way. Her method is a process of unlearning — peeling back the artificial layers we develop in reaction to societal expectations — to reveal the core of who you really are.  On Saturday, March 23, <b>with Artistic Director at The Vox Mundi School of Sound and the Voice Silvia Nakkach, </b>you’ll be guided you through a powerful <b>shamanic listening practice</b> <b>to receive an Icaro or medicine melody on the spot</b>… … revealing how sound and the very nature of your voice originate from a deep well of silence — helping you understand the truth of who you really are when immersed in silence. You’ll explore sound in a new way to “become your voice” — focusing on the <b>shamanic, contemplative, embodied, and artistic </b>aspects of your voice.  <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/byv/knowthyself" target="_blank" rel="noopener noreferrer">You can register here for <b><i>How “Becoming Your Voice” Connects You to Source: Explore How to Reawaken the Wonder of Your Voice as a Spiritual Practice for Healing<<</i></b></a></h3> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/byv/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7405" title="In How “Becoming Your Voice” Connects You to Source: Explore How to Reawaken the Wonder of Your Voice as a Spiritual Practice for Healing with Silvia Nakkach…" src="http://selfimprove.co/wp-content/uploads/2024/03/wonder-of-your-voice-as-a-spiritual-practice-1024x597.jpg" alt="In How “Becoming Your Voice” Connects You to Source: Explore How to Reawaken the Wonder of Your Voice as a Spiritual Practice for Healing with Silvia Nakkach…" width="777" height="453"/></a></p> In this transformative hour-long online event, you’ll: <ul> <li>Unlearn what you’ve been taught about voice and sound to <b>discover the core of who you </b><b><i>really</i></b><b> are</b></li> <li>Discover that silence is more than just a lack of noise; it’s a physical presence that can help you <b>connect to everything around you</b></li> <li>Liberate yourself from societal constraints that tell you you need to be a certain way to <b>express yourself</b></li> <li>Touch the subtle aspects of your being and<b> expand your consciousness </b>through sound and silence</li> <li>Learn how the voice has two aspects — metaphor and materiality — that are constantly in flow with each other <b>so that you can truly liberate or “become” your voice</b></li> </ul> Join Silvia and discover that silence is not merely the absence of noise but a physical presence, a canvas for the “phantom silence and phantom breath” that shapes your understanding of <b>sound and your voice</b>.  <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/byv/knowthyself" target="_blank" rel="noopener noreferrer">>> You can RSVP for free here >></a></h3> In <i>How “Becoming Your Voice” Connects You to Source: Explore How to Reawaken the Wonder of Your Voice as a Spiritual Practice for Healing </i>with Silvia Nakkach… … you’ll explore sound in a new way to become your voice — focusing on the <b>shamanic, contemplative, embodied, and artistic </b>aspects of your voice. We hope you’re able to catch the event as scheduled. But if you register and miss it, you’ll receive a <a href="https://shiftnetwork.infusionsoft.com/go/byv/knowthyself" target="_blank" rel="noopener noreferrer">downloadable recording as soon as it’s available…</a><br/> <p><a href="http://selfimprove.co/discover-the-wonder-of-your-voice-as-a-spiritual-practice/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/745749723372257280https://newblogposts.tumblr.com/post/745749723372257280Sat, 23 Mar 2024 09:59:06 -0400Artistic ExpressionconsciousnessConsciousness ExpansioncontemplativeContemplative PracticeCore Self DiscoveryembodiedEmbodied Practicehealing practicePhantom BreathPhantom SilencePhysical PresenceshamanicShamanic Listeningshamanic practiceSilence ConnectionSilence PresenceSocietal Constraintssonic energysoundSound Originspiritual practicesubtleUnlearning ProcessVocal LiberationvoiceVoice BecomingCeremonialConsciousnessCreativity<img src="https://64.media.tumblr.com/bf9116a0d0446e9a6dcefda3cc5793f3/94aefd54d055e1ab-b7/s500x750/a4ba3734546c2fd7145356a700a9d11ff267ab2d.jpg"/><br/><br/><h2>Get Full Healing Power of Your Herbs, Vitamins & Supplements by Synergizing them</h2> <p></p><h2><b>Watch as master herbalist David Crow potentizes herbs with nutraceuticals.</b></h2> <h3>How many supplements and herbal remedies do you take on a daily basis? </h3> Did you know that using herbs and supplements to treat your symptoms can actually make them worse?  <b>Master herbalist David Crow </b>will share why during his free online event this Thursday, March 21, including demonstrating through hands on mixing and formulating using teas, tinctures, and nutraceutical products how to potentize herbs with nutraceuticals. <h3><a href="https://shiftnetwork.infusionsoft.com/go/shn/knowthyself" target="_blank" rel="noopener noreferrer">>> Register here for <i>Synergizing Herbs & Nutraceuticals for Full-Body Health: Proven Ways to Optimize the Potency of Your Supplements, Vitamins & Herbal Remedies.</i></a></h3> <a href="https://shiftnetwork.infusionsoft.com/go/shn/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7400" title="watch master herbalist David Crow synergizing herbs & nutraceuticals for full-body health optimize potency of vitamins herbal remedies supplements" src="http://selfimprove.co/wp-content/uploads/2024/03/herbalist-David-Crow-synergizing-herbs-nutraceuticals-for-full-body-health-optimize-potency-of-vitamins-herbal-remedies-supplements-1024x597.jpg" alt="watch master herbalist David Crow synergizing herbs & nutraceuticals for full-body health optimize potency of vitamins herbal remedies supplements" width="779" height="454"/></a> The term nutraceuticals denotes the many types of unregulated over-the-counter supplements that have reputed nutritional and therapeutic effects on the body… … that can either optimize your health, do nothing at all, or potentially aggravate symptoms if you don’t know how to properly use them. Learning how to combine herbs and nutraceuticals in a holistic way vs just treating your symptoms as most conventional medicines do, can help you obtain full-body health — and <b>prevent and treat a range of physical, mental, and emotional ailments</b> … whether digestive problems, cognitive issues, boosting cellular health and immunity, detoxifying the body, or easing inflammation. During David’s illuminating online event, you’ll:<b></b> <ul> <li><b>Explore the 8 primary categories of nutraceuticals</b> — and how they can be correlated and combined synergistically with herbs and herbal formulas</li> <li><b>Learn 3 ways that you can potentize herbs with nutraceuticals</b> during a demonstration by David — including mixing and formulating using teas, tinctures, and nutraceutical products</li> <li><b>Discover the importance of knowing the taste, temperature, and energies of nutraceuticals</b> according to the terminology and concepts of Ayurvedic and Chinese medicines</li> <li>Recognize how you can <b>harness the</b> <b>synergies of herbs and nutraceuticals optimizes physiological functions</b> to improve health, reduce symptoms, and prevent illness</li> <li>Discover how correct formulation with herbs can <b>prevent the common misuses and abuses of nutraceuticals products</b></li> </ul> Preventing and treating yourself for health challenges requires a high level of knowledge about your body, how to use the best remedies to improve current symptoms, and most importantly, <i>how to prevent them from worsening</i> and transforming into more chronic conditions. With decades of experience and knowledge, David is masterful at harnessing the energetics of plant medicines and nutraceuticals to harmonize and balance your body systems. <h3>I warmly welcome you to join us on Thursday to learn more about best practices and how to increase the efficiency and potency of your herbs and nutraceuticals when self-treating your ailments. <a href="https://shiftnetwork.infusionsoft.com/go/shn/knowthyself" target="_blank" rel="noopener noreferrer">You can RSVP here</a>.</h3> <h3><a href="https://shiftnetwork.infusionsoft.com/go/shn/knowthyself" target="_blank" rel="noopener noreferrer">Join us this Thursday, March 21, for <i>Synergizing Herbs & Nutraceuticals for Full-Body Health: Proven Ways to Optimize the Potency of Your Supplements, Vitamins & Herbal Remedies…</i></a></h3> … a free online event with <b>master herbalist David Crow</b> where you’ll discover how potentizing herbs with nutraceuticals by combining them can help you take your self-care regimen to a higher level of treatment and prevention and consistently optimize your health holistically. David teaches that <b>herbs and nutraceutical products can be safely synergized and potentized</b> following the principles of Ayurvedic and Chinese medicines — and help us obtain ongoing <i>full-body health</i>.<br/> <p><a href="http://selfimprove.co/get-full-healing-power-of-your-herbs-vitamins-supplements/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/745461182064934912https://newblogposts.tumblr.com/post/745461182064934912Wed, 20 Mar 2024 05:32:51 -0400ayurvedicChinese medicineCorrect FormulationDavid Crowdetoxifyinghealing powerherbal remediesherbalismherbsHigher Levelholistic approachholistic healthimmunitymaster herbalistnatural healthNutraceuticalsOptimize PotencyPhysiological Functionsplant medicinesPotentizeprevent illnesspreventionsupplementsSynergizetreatmentvitaminsAncient MedicineAncient TraditionsAncient WisdomAyurveda<img src="https://64.media.tumblr.com/3b28217257af515b0d39ce909615c439/e9c7e85ef86b2ad8-a3/s500x750/c527820366edc04b9fb8a9b9598a8b50a1bb6d4b.png"/><br/><br/><h2>Unlock Your Limitless Potential 11-day to Wake Up to Your True Destiny Starting Now!</h2> <p></p><h2><strong>Hear from 22 Experts on Transforming Your Existence - Join This FREE 11-Day Event</strong></h2> Have you ever felt like there was more to life than just going through the daily motions? That there was some greater purpose or potential within you, if only you could unlock it?    You’re not alone. Many of us have a sense that we’re meant for something bigger.   That’s why I’m thrilled to let you know about an incredible 11 day online event starting TODAY that will help you discover your limitless potential and transform your existence.    From now until March 26, Gaia is giving you VIP access to 22 of the world’s top personal growth experts, spiritual teachers, and thought leaders, all sharing their most powerful, life-changing insights and practices to help you experience accelerated growth and evolution. And the best part? It’s 100% free to attend.    <h3 style="text-align: center;"><a href="https://www.gaia.com/lp/emersion-live-2024?utm_source=ambassador&oid=18&affid=1676&source_id=seimcopost" target="_blank" rel="noopener noreferrer"><b>Join this incredible event now to transform your life over the next 11 days! >></b></a></h3> <a href="https://www.gaia.com/lp/emersion-live-2024?utm_source=ambassador&oid=18&affid=1676&source_id=seimcopost" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7387" title="Unlock Your Limitless Potential Join Emersion 2024 - 11-day live personal transformation event" src="http://selfimprove.co/wp-content/uploads/2024/03/Unlock-Your-Limitless-Potential-Emersion-2024-1024x576.jpg" alt="Unlock Your Limitless Potential Emersion 2024" width="775" height="436"/></a>   Watching from the comfort of your home, you’ll discover how to break through limiting beliefs and negative thought patterns. You’ll learn scientific, evidence-based techniques to heal and strengthen your mind, body and spirit. And you’ll get actionable advice to help you manifest more wealth, happiness, fulfilling relationships and personal freedom into your life.   World-renowned presenters like Dr. Tara Swart, Dr Joe Dispenza, Chris Wark, Marisa Peer, Gregg Braden, Lee Holden, Bruce Lipton, Bonni McCliss, Lynne McTaggart, and others will reveal specialized methods they’ve spent decades developing, distilled into simple, daily rituals you can start applying right away to radically transform your existence.   <strong>Here’s just a preview of what you’ll discover during the event: </strong><span style="font-weight: 400;"> </span> <ul> <li style="font-weight: 400;">How To Transform Stress Into Your Superpower with Dr. Tara Swart</li> <li style="font-weight: 400;">How to Journey From Your Head to Your Heart with BLU</li> <li style="font-weight: 400;">Discover the Healing Power of Forgiveness with Chris Wark</li> <li style="font-weight: 400;">How to Awaken Your Akashic Wisdom with Bonni McCliss</li> <li style="font-weight: 400;">Magnetize the Life of Your Wildest Imagination with Emily Fletcher</li> <li style="font-weight: 400;">Dynamic Energy Practices to Become Superhuman with Lee Holden</li> <li style="font-weight: 400;">Secrets to Lasting Love with Marisa Peer</li> <li style="font-weight: 400;">Sensitive is the New Strong with Anita Moorjani</li> <li style="font-weight: 400;">Change Your Brain, Change Your World with Jim Kwik</li> <li style="font-weight: 400;">Powerful Ways to Protect & Clear Your Energy with Oliver Niño </li> <li style="font-weight: 400;">Dance Your Way to Freedom with Sah D’Simone</li> </ul>   Whether you want to reduce stress, increase energy levels, unlock intuitive abilities or align with your soul’s purpose, this event will give you an incredible toolbox of practices to help you improve in every area.    <strong>The doors are open now… tune into the live sessions and unlock access to unlimited replays across all 11 days!</strong>   You owe it to yourself to invest in yourself and your growth, and open yourself up to the exciting possibilities ahead. I hope you’ll join Gaia and these brilliant teachers to begin awakening your true human potential.   <h3 style="text-align: center;"><strong><a href="https://www.gaia.com/lp/emersion-live-2024?utm_source=ambassador&oid=18&affid=1676&source_id=seimcopost" target="_blank" rel="noopener noreferrer">>> The next chapter of your life starts now <<</a></strong></h3><br/> <p><a href="http://selfimprove.co/wake-up-to-your-true-destiny-join-this-free-11-day-event/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/745114275342893056https://newblogposts.tumblr.com/post/745114275342893056Sat, 16 Mar 2024 09:38:51 -04005D livingadviceakashiBioGeometryBrainbreak throughchakrasconsciousnessdaily ritualsempathenergyforgivenessfulfillinghappinesshealingimaginationintuitive abilitieslasting lovelimiting beliefsLive Eventmanifestnegative thoughtpersonal freedompersonal growthRelationshipsself helpself improvementsensitivesoul purposespiritual teachers<iframe width="400" height="300" id="youtube_iframe" src="https://www.youtube.com/embed/e7Van4YsK1w?feature=oembed&enablejsapi=1&origin=https://safe.txmblr.com&wmode=opaque" frameborder="0" allow="accelerometer; autoplay; clipboard-write; encrypted-media; gyroscope; picture-in-picture; web-share" referrerpolicy="strict-origin-when-cross-origin" allowfullscreen title="Unlock Your Limitless Potential Wake Up to Your True Destiny #GaiaEmersion #LiveNow #consciousliving"></iframe><br/><br/><h2>Unlock Your Limitless Potential Wake Up to Your True Destiny #GaiaEmersion</h2><h2>Tune in now to join the Gaia Emersion Live Event: <a href="https://bityl.co/emersion" target="_blank">https://bityl.co/emersion</a> - Elevate your consciousness! Explore sessions with renowned thought leaders and unlock the secrets to manifesting abundance in every aspect of your life.</h2><h2><br/>Have you ever felt like there was more to life than just going through the daily motions? That there was some greater purpose or potential within you, if only you could unlock it?</h2><h2><br/> You’re not alone. Many of us have a sense that we’re meant for something bigger.</h2><h2><br/>That’s why I’m thrilled to let you know about an incredible 11 day online event starting TODAY that will help you discover your limitless potential and transform your existence.</h2><h2><br/> From now until March 26, Gaia is giving you VIP access to 22 of the world’s top personal growth experts, spiritual teachers, and thought leaders, all sharing their most powerful, life-changing insights and practices to help you experience accelerated growth and evolution. And the best part? It’s 100% free to attend.</h2><h2><br/> Join this incredible event - <a href="https://bityl.co/emersion" target="_blank">https://bityl.co/emersion</a> - transform your life over the next 11 days!</h2><p>#pesonalgrowth #selfimprovement  #spiritualawakening #GaiaEmersion #LiveNow #ConsciousLiving</p>https://newblogposts.tumblr.com/post/745114052222648320https://newblogposts.tumblr.com/post/745114052222648320Sat, 16 Mar 2024 09:35:34 -0400gaia emersionpersonal growthspiritualityspiritual awakeninglive nowfree eventconsciousnessconscious livingself helpself improvement<img src="https://64.media.tumblr.com/53d311d0201bc38fe3f1ff66c35d9336/6f921505d0e314bb-25/s500x750/4388c88c103f438c0c92968d75016b41af6ba1f8.jpg"/><br/><br/><h2>See How You Can Decipher Symbols, Omens, Synchronicities & Dreams</h2> <p></p><h2><b>Interpret signs from your soul to upgrade your innate psychic abilities.</b></h2> <strong>Do you sometimes sense who’s knocking at your door before you open it? Or have a dream about an old friend you haven’t seen in years and surprisingly run into them the next day?</strong> If so, you’re certainly intuitive, but you may also be well on your way to being an effective psychic. According to<b> psychic counselor Lisa Campion</b>, dreams like that and “gut” hunches are just two of the many ways to receive psychic messages. She teaches that we <i>all</i> have the ability to access knowledge, wisdom, and guidance from our own soul — or Higher Self — which is always speaking to us through signs and symbols. Join Lisa in a free video event, in which <b>you’ll get a taste of doing your first soul reading</b>! It’s a transformative process that you can start to practice and apply daily… …. to <b>obtain guidance and important information that can help you live a more soulful life</b>, find more joy, and navigate the challenges you encounter with skill and conscious awareness. Lisa will show you how to tap into your intuition — and when you combine your intuition with psychic signs you receive, you’ll be better equipped to <b>interpret those soul-given messages and confirm their validity</b>. <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/yos/knowthyself" target="_blank" rel="noopener noreferrer">>> You can register here for <b><i>How to Read Your Own Soul: Upgrade Your Psychic Skills by Tapping Into Messages From Your Higher Self  <<</i></b></a></p> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/yos/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7381" title="Interpret signs from your soul to upgrade your innate psychic abilities " src="http://selfimprove.co/wp-content/uploads/2024/03/Learn-How-to-decipher-symbols-omens-synchronicities-dreams-1024x597.jpg" alt="Interpret signs from your soul to upgrade your innate psychic abilities " width="777" height="453"/></a></p> <b>In this empowering online event, you’ll:</b><b></b> <ul> <li>Explore how your soul is always speaking to you through your intuition, dreams, signs, omens, synchronicities — <b>offering useful guidance for navigating challenges and living a more soulful life</b></li> <li>Understand how important it is to discern the difference between the needs and goals of your personal self and the desired evolution of your soul — and how it’s possible to fulfill both</li> <li>Learn how to<b> build trust and confidence in the messages and guidance you’re receiving </b>from your soul by tapping into your intuitive knowing </li> <li>Learn how to <b>use both sides of your brain to decode psychic messages</b>  </li> <li><b>Be guided in</b> <b>a meditation </b>to connect with your Higher Self and receive a message about something that’s now unfolding in your life </li> </ul> Lisa will show you how to <b>enter an alpha brainwave state </b>to tune in to the right side of your brain, which houses your intuition and recognizes signs, symbols, and omens. You can then, at will, allow the left side of your brain to take over, decode, and make meaning of those psychic clues. If you’re at a crossroads and looking for a deeper connection to your internal guidance system, this hour with Lisa promises to <b>ignite a spark of confidence in the wellspring of knowledge and insight awaiting to be accessed</b> <b>within you</b>.   <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/yos/knowthyself" target="_blank" rel="noopener noreferrer">>> You can RSVP for free here <<</a></h3><br/> <p><a href="http://selfimprove.co/how-to-decipher-symbols-omens-synchronicities-dreams/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/745011041111539712https://newblogposts.tumblr.com/post/745011041111539712Fri, 15 Mar 2024 06:18:01 -0400alpha brainwave statechallengesconfidenceconnectconscious awarenesscrossroadsdecodediscerndoordreamempoweringenseevolutionguidanceguided meditationguided practicegut hunchesHigher Selfinsightinternal guidance systeminterpretintuitionIntuitivejoyknockingknowledgeleft side of the brainLisa Campionmeaningmeditation<img src="https://64.media.tumblr.com/1c318f36e976f8a1da5ffdca7020f90b/5f26f8b900f9b946-07/s500x750/14515deb9e30bd7a120b7dbf05cc84b107f800e4.jpg"/><br/><br/><h2>Attain the Strength, Grace & Agility of Animals with 5-Animal Qigong</h2> <p></p><h2 dir="ltr">Have you ever noticed how animals stay agile and active as they age? What if we could learn their secrets?</h2> <p dir="ltr"><strong>Animals intuitively understand when to rest and when to play. And when they’re hungry, they skillfully hunt for food, says Daisy Lee, founder and principal teacher of Radiant Lotus Qigong.</strong></p> <p dir="ltr">Register to join Daisy on Tuesday, March 12 for a special event with the Shift Network as she shares how the wisdom and wellbeing of animals first inspired China’s renowned master physician Hua Tuo to create the joyful practice of 5-Animal Qigong 1,800 years ago.</p> <h3 dir="ltr" style="text-align: center;"><strong><a href="https://shiftnetwork.infusionsoft.com/go/5aq/knowthyself" target="_blank" rel="noopener noreferrer">>> RSVP here: Rewild Your Senses Through the Practice of “5-Animal” Qigong: Embody the Virtues of Specific Animals Through Movement.</a></strong></h3> <h3 dir="ltr" style="text-align: center;"><strong><a href="https://shiftnetwork.infusionsoft.com/go/5aq/knowthyself" target="_blank" rel="noopener noreferrer"> </a><a href="https://shiftnetwork.infusionsoft.com/go/5aq/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7376" title="Attain the strength, grace & agility of animals with 5-Animal Qigong" src="http://selfimprove.co/wp-content/uploads/2024/03/Attain-the-strength-grace-agility-of-animals-with-5-Animal-Qigong-1024x597.jpg" alt="Attain the strength, grace & agility of animals with 5-Animal Qigong" width="777" height="453"/></a><a href="https://shiftnetwork.infusionsoft.com/go/5aq/knowthyself" target="_blank" rel="noopener noreferrer"> </a></strong></h3> <p dir="ltr">You’ll have the chance to explore how the movements of 5-Animal Qigong emulate animals’ natural agile movements and easy grace. </p> <p dir="ltr">It’s an uplifting path to rewild your senses — reconnecting with your most natural state and returning to the wisdom of the animals. Along the way, you’ll cultivate vibrant physical, emotional, and spiritual health and wellbeing.</p> <p dir="ltr">In this workshop, you’ll explore:</p> <ul> <li dir="ltr"> <p dir="ltr">The origins of this playful, joyful 5-Animal Qigong, and why it has lasted through the centuries</p> </li> <li dir="ltr"> <p dir="ltr">A guided Qigong form inspired by the tiger that helps you learn how to conserve energy while still being playful, noble, and aligned with the timing of the spring equinox</p> </li> <li dir="ltr"> <p dir="ltr">How the inner and outer qualities of the animals can strengthen your body and brain, and balance your emotions</p> </li> <li dir="ltr"> <p dir="ltr">How to build your own inner and outer qualities as learned from the animals — including action and restorative rest, strength and flexibility, and a clear and vibrant mind</p> </li> <li dir="ltr"> <p dir="ltr">How to cultivate the animals’ natural practices in your daily life, including intuition, rest, action, movement, and natural nutrition</p> </li> </ul> <p dir="ltr">As you connect with the energy of the animals, you’ll retrieve the treasures of the past — a more grounded, centered, and far less complex way of engaging with life in a world inundated by social, global, and technological stressors.</p> <p dir="ltr">When you join us, you’ll also learn about Daisy’s new live 7-week video course where she’ll guide you through the 5-Animal Qigong form in its entirety, just as she learned it from her lineage teacher, Master Wang San Hua, in Bo Zhou, China.</p> <h3 dir="ltr" style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/5aq/knowthyself" target="_blank" rel="noopener noreferrer">>> I hope you’ll join us! Register here <<</a></h3> <p dir="ltr">When you attend celebrated Qigong teacher Daisy Lee’s new online event, Rewild Your Senses Through the Practice of 5-Animal Qigong, you’ll learn a new movement inspired by the Tiger. </p> I hope you’ll join us as scheduled on Tuesday, March 12. But if you register and miss it, you’ll <a href="https://shiftnetwork.infusionsoft.com/go/5aq/knowthyself" target="_blank">receive a recording soon after the event concludes. Register here</a><br/> <p><a href="http://selfimprove.co/attain-the-strength-grace-agility-of-animals-with-5-animal-qigong/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/744553999233056768https://newblogposts.tumblr.com/post/744553999233056768Sun, 10 Mar 2024 05:13:33 -0400actionactiveagingalignedanimal movementsAnimal QigongBalanceBo ZhoucenteredChinaclear mindconserve energycultivatedaily lifeDaisy Leeemotionsengagingflexibilityfree traininggroundedHua Tuohungerhunt for foodinner qualitiesintuitionjoyfullearn qigongless complexlifelineage teacher<img src="https://64.media.tumblr.com/383605cbdd5a0c5976ff5e985a9fd70e/88c363e942c2211b-63/s500x750/03f449eac97a026f6aeb62df6f8ed0ef84fed6f1.jpg"/><br/><br/><h2>Combine Power of Your Chakras & Vagus Nerve to Heal Trauma</h2> <p></p><h2><b>Discover How to Connect your soul’s desire with your 7 chakras & vagus nerve.</b></h2> <strong>Have you ever wondered what your soul wanted to experience when it decided to have a human life on this earthly plane?</strong> Whether to enjoy the embodied pleasures of a worldly existence or pursue the spiritual fulfillment of purpose and love, your soul wants to take the wheel and live out a <b>meaningful and delightful journey</b>. As you travel through your life, however, you inevitably encounter traumatic experiences, and the resulting <b>pain and fear become imprinted in your nervous system</b>. Your nervous system then sends you all kinds of warning signals that may stop you from moving forward to manifest your soul’s desires. How do you manage this conflict— the conundrum of<b> living out the tension between your human and spiritual being-ness</b>? How do you heal this fracture so you can fulfill your soul’s quest?<b> </b> <b>Trauma therapist and author C.J. Llewelyn, </b><b>M.Ed., LPC, </b><b>specializes in guiding people through this process</b>, asserting that navigating the tension between the soul’s desires and the body’s innate drive for self-preservation is at the core of the human condition. <b>In this illuminating free online event </b><b>on Thursday, March 7</b>, C.J. will reveal the intricate connection between your vagus nerve and your seven main chakras — and how, when they’re optimized and working together, they can be a source of <b>profound psychological and spiritual healing</b>. From C.J.’s groundbreaking perspective, your chakras hold the etheric energy of your soul, while your vagus nerve — the largest part of your autonomic nervous system — keeps you safe. What C.J. teaches is a <i>one-of-a-kind</i> approach and <b>a paradigm shift that will transform how you interact with your world</b>. She can show you how to reconcile the passions of your soul (expressed through your chakras) with the fear of your humanity (expressed through your vagus nerve) by<b> weaving the two together so you can live into your fullest potential and highest purpose</b>. <blockquote><a href="https://shiftnetwork.infusionsoft.com/go/scvn/knowthyself" target="_blank" rel="noopener noreferrer">> You can register here for <b><i>Connect Your Soul’s Desires With Your Chakras & Vagus Nerve: Learn to Calm Your Nervous System So Your Soul Can Guide Your Life <<</i></b></a></blockquote> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/scvn/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7370" title="Combined power of your chakras & vagus nerve to heal trauma" src="http://selfimprove.co/wp-content/uploads/2024/03/Tap-into-the-combined-power-of-your-chakras-vagus-nerve-to-heal-trauma-1024x597.jpg" alt="Combined power of your chakras & vagus nerve to heal trauma" width="770" height="449"/></a></p> <b>In this fascinating workshop, you’ll:</b> <ul> <li><b>Discover the duality between what your soul wants to experience as a human being, and how your body  is holding you back</b> from living your soul’s desires because it wants to protect you from danger</li> <li><b>Be guided in a 7 chakra/vagus nerve visualization</b> to access your own soul messaging as you begin to regulate your vagus nerve</li> <li>Understand how, when you experience trauma, <b>the residue becomes imprinted into your vagus nerve</b>, which can take you off your soul’s course</li> <li>Learn why calming your nervous system and releasing your body’s fears enables your soul to have the fullest experience possible — by <b><i>weaving </i></b><b>together the functionality of your vagus nerve and your chakras</b></li> <li>Explore yourself as a spiritual being having a human experience — and understand that <b>your soul came into your body to know what it’s like to live in this world</b></li> </ul> C.J. will explain exactly <i>how</i> your traumatic experiences are stored in your vagus nerve and the ways they influence your perceptions of the world — because <b>your nervous system is built to override the pull of your wiser soul energy when a threat is perceived</b>. When you actively engage in the practice of calming your nervous system by identifying and navigating signals from your vagus nerve, C.J. explains that <b>you are reprogramming your neural wiring so it doesn’t trigger unnecessary fight/flight/freeze responses</b>. And, <b>as you move toward a state of sustainable inner peace, your trauma begins to heal </b>and the soul energy of your chakras can start to drive your choices. <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/scvn/knowthyself" target="_blank" rel="noopener noreferrer">You can RSVP for free here</a></h3><br/> <p><a href="http://selfimprove.co/combine-power-of-your-chakras-vagus-nerve-to-heal-trauma/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/744287077862113280https://newblogposts.tumblr.com/post/744287077862113280Thu, 07 Mar 2024 05:30:57 -0500calmingchakraenergy healingfull potentialguided healingguided practicehealhealinginner peacemain chakrasnervous systempsychological healingself healingself helpseven chakrassoulsoul energyspiritual healingtraumavagusvagus nervevisualizationBodyChakraChakrascoursesEducationEnergy HealingEnergy MedicineGuided<img src="https://64.media.tumblr.com/ed2e654b6c691585c3c7eef5c0f6335e/e11e4320c9083392-77/s500x750/36031c4ec0334f9b5577131476963b300560fa6e.jpg"/><br/><br/><h2>Reprogramming Your Brain to Dramatically Transform Your Health</h2> <p></p><h2><b>Create new neural pathways to improve your health & relationships.</b></h2> <strong>Are you seeking solutions for persistent health challenges? </strong> Maybe you’ve tried meditation or alternative methods for healing, but nothing seems to work. You have the power to truly change your life when you change your thoughts, says <b>Brandy Gillmore</b>, <b>mind-body-energy expert.</b> The question is, <i>how</i>, exactly, do you make this happen? It’s not as easy as just “thinking differently,” Brandy says, and popular practices like meditation just aren’t enough. Join Brandy on <b>Tuesday, March 5 </b>for a<b> brand-new hour-long event</b> as she explores how repatterning the way your mind responds to emotional connections, energy, and the relationships in your life can unlock your body’s self-healing ability. <p style="text-align: center;"><strong><a href="https://shiftnetwork.infusionsoft.com/go/ryb/knowthyself" target="_blank" rel="noopener noreferrer">>> Register here: <i>How to Reprogram Your Brain for Healing: Transforming Negative Thought Patterns Into New Neural Pathways to Improve Your Health & Relationships << <a href="https://shiftnetwork.infusionsoft.com/go/ryb/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7364" title="Join Brandy on Tuesday, March 5 for a brand-new hour-long event as she explores how repatterning the way your mind responds to emotional connections, energy, and the relationships in your life can unlock your body’s self-healing ability." src="http://selfimprove.co/wp-content/uploads/2024/02/Reprogramming-your-brain-to-dramatically-transform-your-health-1024x597.jpg" alt="Reprogramming your brain to dramatically transform your health" width="777" height="469"/></a> </i></a></strong></p> Brandy will guide you through a powerful visualization practice to reveal how underlying emotional hurt — for example, negativity you may be experiencing in a relationship — can impact your energy right on the spot, while positive emotions also have immediate physical impacts. <b>In this hour-long, free online event, you’ll explore:</b> <ul> <li>A <b>guided visualization “awareness” practice </b>to experience first-hand how negative emotions can instantly impact your energy — and how positive emotions have immediate physical impacts, too</li> <li>The surprisingly <b>counterintuitive role of love and self-love</b> in your healing process (or in illness and injuries)</li> <li>What Brandy learned from the breakthrough discovery that people with multiple personalities can have different ailments when they are in different personalities — providing fascinating insights into the <b>connection between energy and emotions</b>, and how you can create a radical shift in your health</li> <li><b>Misconceptions about energy healing</b> that are keeping you stuck — including the myth that practices such as meditation and theta state relaxation can change your mind’s programming (they actually can’t, says Brandy)</li> <li>How Sigmund <b>Freud’s work on repetition compulsion</b> illustrates how your emotional patterns can repeat themselves — and how you can change your patterned ways of thinking and feeling</li> </ul> If you feel like you’ve tried everything to heal but have been unable to achieve true healing, or if you’ve made progress but haven’t yet made a full recovery, then I encourage you to come to this transformative event with Brandy. <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/ryb/knowthyself" target="_blank" rel="noopener noreferrer">>> RSVP right here to watch live event or/and get recording later >></a></h3> Create new neural pathways to improve your health and relationships. When you join us for<i> How to Reprogram Your Brain for Healing </i>with <b>Brandy Gillmore</b>, <b>mind-body-energy expert, </b>you’ll gain clarity on how to achieve radical healing results. I hope you’ll <b>join the event as scheduled on Tuesday, March 5</b>. But if you register for the event and miss it, you’ll receive a recording soon after the event concludes.<br/> <p><a href="http://selfimprove.co/reprogramming-your-brain-to-dramatically-transform-your-health/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/743668952355471360https://newblogposts.tumblr.com/post/743668952355471360Thu, 29 Feb 2024 09:46:08 -0500ailmentsalternative methodsawarenessbodyBrainBrandy Gillmorebreakthrough discoverychange your thoughtsclarityconnectioncounterintuitiveemotional blissemotional connectionsemotionsenergyenergy expertenergy healingFeelingfull recoveryguided visualizationhealing processHealthinsightsinterruptLovemake this happenmeditationMindmind's programmingmisconceptions<img src="https://64.media.tumblr.com/a19a1ef752037691410ebee6713e3a7c/7590201f707fb070-46/s500x750/0301dda22b7e614ac75bd825c2d1242b629752a3.jpg"/><br/><br/><h2>Explore What it Means to be a Green Witch to Enhance your Health</h2> <p></p><h2><b>Meet your inner Green Witch & Understand how plants can deepen your intuition. </b></h2> <strong>How would your life be different if you considered plants and trees to be sentient beings?</strong> There is a fascinating new movement of people called “Green Witches.” They believe that, while plants can provide us with medicines and healing, they don’t exist just for us. Plants have an independent sentience that calls for a deeper kind of partnership and dialogue.   It’s an intriguing extension of the realization that Spirit animates the entire cosmos and that sentience is much wider than we first imagined. On Wednesday, February 28, <b>with Green Witch Robin Rose Bennett, you’ll learn</b> <b>what it means to be a Green Witch</b> — someone who respects plants as sentient, living beings, and who understands that while plants do provide us with medicines and healing, they don’t exist just for us. During the event, Robin Rose will guide you through <b>a ritual journey to connect with your inner Green Witch</b> — your authentic, natural self and the ultimate authority on what is true and good for you, so you can receive guidance and feel deeply connected to the Earth. Walking the path of the Green Witch can help you attain a profound sense of peace, a <b>stronger connection with your inner wisdom</b>, and a renewed sense of belonging in the web of life. <blockquote> <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/igw/knowthyself" target="_blank" rel="noopener noreferrer">You can register here for <b><i>Meet Your Inner Green Witch: Discover Your Wise, Wild Essence Through the Healing Power of Root, Leaf, Flower & Tree Medicines <<</i></b></a> <a href="https://shiftnetwork.infusionsoft.com/go/igw/knowthyself" target="_blank"><img class="aligncenter wp-image-7359" src="http://selfimprove.co/wp-content/uploads/2024/02/Explore-what-it-means-to-be-a-Green-Witch-to-enhance-your-health-1024x597.jpg" alt="Explore what it means to be a Green Witch to enhance your health" width="777" height="453"/></a> </p> </blockquote> <b>In this enriching free online event, you’ll:</b> <ul> <li>Gain a clear understanding of <b>what it means to be a Green Witch — </b>and how this path can enrich your life, opening doors to a world where plants are more than just pretty vegetation or delicious ingredients; they’re teachers and healers</li> <li><b>Meet your inner Green Witch</b>, a powerful source of wisdom and guidance that lies within you, waiting to be discovered and embraced through a guided meditative journey</li> <li>Discover how to make the Sacred Moments Herbal Smoke Blend, a ceremonial recipe to invoke Spirit — enhancing your spiritual practice, <b>deepening your connection with the Earth</b> and your inner wisdom, and relaxing you in body and mind</li> <li>Explore the <b>unique benefits of herbs</b> like Mullein, Coltsfoot, and Mugwort — and understand how these plants can be used in everyday life to deepen your intuition and connect you more profoundly with your inner self</li> </ul> Join Robin Rose and discover how you can deeply connect with the plants and flowers around you so you can receive their healing gifts, affirming that you are one with <i>all</i> living beings on Earth, and <b>providing you with a potent sense of kinship and a powerful antidote to loneliness.</b> <p style="text-align: center;"><strong><a href="https://shiftnetwork.infusionsoft.com/go/igw/knowthyself" target="_blank" rel="noopener noreferrer">>> You can RSVP for free here >></a></strong></p> In <i>Meet Your Inner Green Witch: Discover Your Wise, Wild Essence Through the Healing Power of Root, Leaf, Flower & Tree Medicines </i>with Green Witch Robin Rose Bennett…  … you’ll explore what it means to be a Green Witch — honoring plants and trees as loving, conscious beings — and discover how you can work with them to enhance your health, deepen your intuition, and connect with nature.   <p dir="ltr">We hope you’re able to catch the event as scheduled. But if you register and miss it, you’ll receive a <a href="https://shiftnetwork.infusionsoft.com/go/igw/knowthyself" target="_blank">downloadable recording as soon as it’s available</a>.</p><br/> <p><a href="http://selfimprove.co/explore-what-it-means-to-be-a-green-witch-to-enhance-your-health/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/743569542135070720https://newblogposts.tumblr.com/post/743569542135070720Wed, 28 Feb 2024 07:25:58 -0500alternative medicineantidoteceremonial recipeColtsfootCosmosdialogueEarthflower medicinegreen witchGreen Witch movementguided meditationhealinghealing giftsherbal medicineHerbal Smokeherbsinner wisdomkinshipliving beingslonelinessmeditative journeyMugwortmulleinonline eventpartnershipplant medicineplantsritual journeySacred Moments Herbal Smoke Blendself healing<img src="https://64.media.tumblr.com/9aab255c124fef116e1fc1897e504d86/6f362b7bac595157-48/s500x750/0946a6fd8f902b29778df7a87f9a00bc1878e8fd.jpg"/><br/><br/><h2>Unlock Your Intuition by Attuning to The Higher Vibrations of Life for Empaths & HSPs</h2> <p></p><h2><b>Join us to receive a channeled message from the Beings of Light.</b></h2> <strong>Have you ever felt the physical, mental, or emotional pain of someone else and instead of lifting them up your energy <i>lowered </i>to meet their vibration? </strong> That’s the greatest challenge of empathy, say <b>Rob Schwartz, a between-life soul regression hypnotist,</b> and his wife, co-teacher, and <b>channeler Liesel Fricke</b>… … but it’s also a great gift — once you learn how to attune to the higher vibrations of life such as love, joy, and peace and are able to maintain your vibration regardless of what’s happening outside of you. <p style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/tuyi/knowthyself" target="_blank" rel="noopener noreferrer"><img class="aligncenter wp-image-7354" title="Tune In & Turn Up Your Intuition, Use your Empathy and Sensitivity to Merge into the Vibration of Oneness Consciousness & Overcome Turmoil" src="http://selfimprove.co/wp-content/uploads/2024/02/Tune-In-Turn-Up-Your-Intuition-Use-your-Empathy-and-Sensitivity-to-Merge-into-the-Vibration-of-Oneness-Consciousness-Overcome-Turmoil-1024x597.jpg" alt="Tune In & Turn Up Your Intuition, Use your Empathy and Sensitivity to Merge into the Vibration of Oneness Consciousness & Overcome Turmoil" width="775" height="452"/></a></p> <h3>During this 60 min free online event called: <i>Tune In & Turn Up Your Intuition, </i><a href="https://shiftnetwork.infusionsoft.com/go/tuyi/knowthyself" target="_blank" rel="noopener noreferrer"><i>Use your Empathy and Sensitivity to Merge into the Vibration of Oneness Consciousness & Overcome Turmoil,</i> with Rob and Liesel on Saturday, February 24</a>…</h3> … you’ll explore how to do just that as they share how you can begin to <b>“turn the dial” to more expansive frequencies</b> to infinite your intuition and empower your empathic and sensitive nature. During this event, you’ll: <ul> <li>Explore how attuning to the vibrations of love, peace and joy can help you <b>effectively work with the gifts of empathy and sensitivity</b> </li> <li>Learn how you can <b>“turn the dial” to different frequencies</b> using attention and intention — and start expanding your capacity for empathy and sensitivity </li> <li>Be guided in <b>a powerful meditation channeled by Liesel from the Beings of Light</b> to open to the deep love of your higher self, spirit guides, angels, and ascended masters </li> <li>Discover <b>the Divine virtues that we are are often working on</b> as a soul choosing to incarnate at this time and era of ascension — allowing for greater ease and a release from suffering while here on Earth</li> <li>Receive potent tips for how you can <b>thrive as an intuitive empath or HSP during this tumultuous time</b> of evolution</li> </ul> Compassionate wayshowers in this liminal time of personal and collective evolution, Rob and Liesel share a profound ability to help others reach their full potential by activating their intuition — and attuning to the greater plan for their lives. This begins with a deep remembrance of their Divine virtues, which Rob and Liesel spark through meditation, hypnotic regression, and channeled messages from the Beings of Light. In joining us, you’ll gain potent tools that will help you <b>attune to love, your higher self, spirit guides, angels, and ascended masters</b> as you as you explore the greater purpose of your empathic gifts. <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/tuyi/knowthyself" target="_blank" rel="noopener noreferrer">>> If this resonates with you, you can RSVP here for Rob and Liesel’s event <<</a></h3> Join us on Saturday, February 24, for <i>Tune In & Turn Up Your Intuition: </i><i>Use your Empathy and Sensitivity to Merge into the Vibration of Oneness Consciousness & Overcome Turmoil</i>, a free online event with <b>Rob Schwartz, a between-life soul regression hypnotist,</b> and his wife, co-teacher, and <b>channeler Liesel Fricke.</b> With Rob and Liesel, you’ll raise your vibration through unity consciousness and the loving wisdom of the Beings of Light to accelerate your ascension, access more expansive frequencies, and catalyze the healing potential of your empathic and intuitive gifts. You’ll also be among the first to learn about their new 7-week course on how your Divine virtues can help you transmute suffering and trauma and embody the gifts of empathy and sensitivity — to positively transform your life and our world. <h3 style="text-align: center;"><a href="https://shiftnetwork.infusionsoft.com/go/tuyi/knowthyself" target="_blank" rel="noopener noreferrer">>> Register here to join us!</a></h3><br/> <p><a href="http://selfimprove.co/unlocking-your-intuition-by-attuning-to-the-higher-vibrations-of-life/" target="_blank">Click Here to Read More</a></p>https://newblogposts.tumblr.com/post/742961749905539072https://newblogposts.tumblr.com/post/742961749905539072Wed, 21 Feb 2024 14:25:22 -0500angelsascended mastersbeings of lightchannelingconsciousnessemotional painempathicempathsempathyfrequenciesguided meditationhealingHigher Selfhigher vibrationhigher vibrationsHSPhypnotistintuitionintuitive giftsjoyLovemeditationmental painOnenesspeacephysical painself helpself improvementSensitivessensitivity