tag:blogger.com,1999:blog-2665522891664997409Wed, 28 Aug 2024 13:04:22 +0000musicblogfashionBBCdocumentarygadgetsmusthave monday2manydjsAnya SingletonCERNLarge Hadron ColliderLondon Fashion Weekaccessoriesaeroplaneartbebel gilbertobirthdaybossa novaboysbraceletsbrainfoodbrazilbyrdscameracamerapartscasecatwalkcatzchococasechocolatecircle of lovecuffsdas popde zuiddebut cdeagleserol alkanfolk rockfree musicgamegamesguitarheadphoneshomeiPhoneinstrumentinteractivejokejoost van bellenjusticelowlandsmaassilomidnight mikemoviesmovingpaul chambers livepetitiephysicspoemquoteritonrockscheveningensciencesinger/songwritersoulwaxsoulwaxmasspring/summer 2009streetwearsurfsurfingsurfverbodtigausabilityvideoand you're invited.http://yourdailyintake.blogspot.com/noreply@blogger.com (Liliane)Blogger29125tag:blogger.com,1999:blog-2665522891664997409.post-7434755480102021797Sun, 22 Feb 2009 14:13:00 +00002009-02-22T15:15:23.700+01:00blogmovingUpdate your bookmarks!http://yourdailyintake.comYes, that's right, I got my own domain ;)(Still working on my layout, posts and RSS-feed, so be patient with me!)http://yourdailyintake.blogspot.com/2009/02/moved.htmlnoreply@blogger.com (Liliane)0tag:blogger.com,1999:blog-2665522891664997409.post-2769282602179197177Wed, 11 Feb 2009 20:01:00 +00002009-02-11T21:03:33.938+01:00circle of lovede zuidpetitiescheveningensurfsurfingsurfverbodFollow the link.Sorry, it's in Dutch!http://www.surfholland.nl/content/view/1081/http://yourdailyintake.blogspot.com/2009/02/red-de-zuid.htmlnoreply@blogger.com (Liliane)0tag:blogger.com,1999:blog-2665522891664997409.post-7773382111596574390Thu, 18 Dec 2008 14:00:00 +00002008-12-18T18:28:19.109+01:002manydjsaeroplanedas poperol alkanjoost van bellenjusticemaassilomidnight mikemusicpaul chambers liveritonsoulwaxsoulwaxmastigaTomorrow, 19th December 2008, Soulwaxmas @ Maassilo Rotterdam!You really really REALLY want to be there :)!There will be also a showing of the new DVD 'Part of the weekend never dies'.If you won't be able to go to soulwaxmas (due to no time, no money or you just didn't know, imo very unlikely ;) ) you can watch it this week only for free at Pitchfork.tvSee you there! or not ;)http://yourdailyintake.blogspot.com/2008/12/part-of-weekend-never-dies.htmlnoreply@blogger.com (Liliane)1tag:blogger.com,1999:blog-2665522891664997409.post-4622733959549930759Fri, 05 Dec 2008 08:50:00 +00002008-12-05T10:00:08.279+01:00Played this game at 5am, dark outside, lights out, silence.Freaky game when you're suffering from insomnia ;)Maybe it was the lack of sleep, maybe it was not. oh no, oh no, something is coming, I just know it!!evenso I still sat totally tensed behind my computer hahaAnyways, game is only open between 6pm and 6am.Change the clock on your computer to play it during the day :) but it won't be as http://yourdailyintake.blogspot.com/2008/12/hotel-626.htmlnoreply@blogger.com (Liliane)2tag:blogger.com,1999:blog-2665522891664997409.post-5662661381530033445Sat, 29 Nov 2008 16:26:00 +00002008-11-29T17:35:45.347+01:00BBCbyrdsdocumentaryeaglesfolk rockrockDocumentary looking at the music and mythology of a golden era in Californian culture, and telling the story of how Los Angeles changed from a kooky backwater in the early 1960s to become the artistic and industrial hub of the American music industry by the end of the 1970s.Alongside extensive and never before seen archive footage, the programme features comprehensive first-hand accounts of the http://yourdailyintake.blogspot.com/2008/11/hotel-california-la-from-byrds-to.htmlnoreply@blogger.com (Liliane)0tag:blogger.com,1999:blog-2665522891664997409.post-2249756466531191747Thu, 30 Oct 2008 17:08:00 +00002008-10-30T18:12:58.404+01:00birthdayHappy birthday to me, or as we say it in Holland: Hiep Hiep Hoera! Lang zal zij leven!Thanks for all the sweet messages, calls, postcards etc! You make my world go round :)Anyways, exam tomorrow, so it will be a late call tonight!http://yourdailyintake.blogspot.com/2008/10/happy-birthday-to-me.htmlnoreply@blogger.com (Liliane)2tag:blogger.com,1999:blog-2665522891664997409.post-5167280056009648319Fri, 17 Oct 2008 21:44:00 +00002008-10-17T23:56:01.762+02:00brainfoodBrainfood.I am surrounded by books (and brainfood & tea)exams.So if it takes a little longer than it normally does to get an answer from me, you know why!http://yourdailyintake.blogspot.com/2008/10/brainfood.htmlnoreply@blogger.com (Liliane)1tag:blogger.com,1999:blog-2665522891664997409.post-657809541041176373Mon, 06 Oct 2008 19:45:00 +00002008-10-06T22:26:56.576+02:00BBCdocumentaryguitarinstrumentmusicSome of my readers know that I have been playing this wonderful instrument since I was a little girl. I started with classical guitar but the electric guitar was always lurking in the background (my parents weren't that enthousiastic about that in the beginning, afraid that I would blow up the house with the amplifier I guess :D I think they made the right decision to let me wait a few years http://yourdailyintake.blogspot.com/2008/10/story-of-guitar.htmlnoreply@blogger.com (Liliane)5tag:blogger.com,1999:blog-2665522891664997409.post-4195741828066010826Fri, 19 Sep 2008 09:29:00 +00002008-09-19T12:05:07.793+02:00catwalkfashionLondon Fashion Weekspring/summer 2009So today is the last day of London Fashion Week for the Spring/Summer 2009 collection. Yeah, that's no mistake, for the ones that do not know, the fashion world is always a step ahead. Is it Winter? Oh let's present our collection with short skirts, flirty dresses and sunglasses!I wanted to give you an overview of my favorite shows but I came to the conclusion that I liked too many ;)So I guess http://yourdailyintake.blogspot.com/2008/09/london-fashion-week.htmlnoreply@blogger.com (Liliane)1tag:blogger.com,1999:blog-2665522891664997409.post-539838240419540860Mon, 15 Sep 2008 06:00:00 +00002008-09-16T12:07:01.299+02:00accessoriesbraceletscameracamerapartscuffsfashionmusthave mondayCan not live without your camera, your companion in taking those nice shots of your everyday life? I wish I could take my camera everywhere with me, now we can!Re:vision's designer Craig Arnold came up with the idea to take a camera, strip it from its parts and make bracelets out of it! With different models ranging from Depth of field to Focus, I am sure that there will be cameraparts err.. http://yourdailyintake.blogspot.com/2008/08/musthave-monday-revision-cuffs.htmlnoreply@blogger.com (Liliane)0tag:blogger.com,1999:blog-2665522891664997409.post-3251202670135518086Sat, 13 Sep 2008 21:05:00 +00002008-09-15T12:58:00.769+02:00CERNLarge Hadron ColliderphysicsscienceSo today I went running - Yes, even when it is cold and it rains, do not ask.. -, I did some reading in my philosophy book - Why does my teacher write in such a 'floaty' way? Is it because he is from Belgium or because it ís after all philosophy? Maybe it is a combination of both - , then I watched Strictly come dancing on the BBC - No, I am not ashamed of it, that program is so funny (how I lovehttp://yourdailyintake.blogspot.com/2008/09/large-hadron-collider-anyone.htmlnoreply@blogger.com (Liliane)0tag:blogger.com,1999:blog-2665522891664997409.post-8551760962359289380Fri, 12 Sep 2008 09:05:00 +00002008-09-12T11:40:52.264+02:00gameinteractivemusicvideoAlways wanted to make your own video? MGMT will make your dreams come true.Requirements:Computer with a connection to the almighty internet (guess you already have this, otherwise you wouldn't be reading this ;) )Quicktime 7The MGMT zipfile (get it here)Some kind of groovyness in your fingers to make the ultimate Time to pretend video! Btw, you should check out MGMT. My big toe (ya really) is http://yourdailyintake.blogspot.com/2008/09/mgmt-time-to-pretend-interactive-video.htmlnoreply@blogger.com (Liliane)0tag:blogger.com,1999:blog-2665522891664997409.post-3824548770371274544Tue, 26 Aug 2008 06:00:00 +00002008-08-26T08:00:01.084+02:00casechococasechocolateiPhoneYou probably have heard about the LG Chocolate, but mmm, I sure would like to get my teeth in this one!And it does not melt in your pocket, how is that for a chocolate iPhone!I am craving chocolate now, not good.Get yours herehttp://yourdailyintake.blogspot.com/2008/08/chocolate-anyone.htmlnoreply@blogger.com (Liliane)0tag:blogger.com,1999:blog-2665522891664997409.post-8564562549717785076Sun, 24 Aug 2008 11:11:00 +00002008-08-24T13:46:27.792+02:00Anya Singletondebut cdmusicsinger/songwriterIt's like there is a factory somewhere, somehow, that produces singer/songwriters by the dozen every hour. I do not mind the hype about new singer/songwriters, especially not if it is about someone like Anya Singleton. I am honored to be part of her growing fame or name with this blogpost.With her pure sound she conquered my heart. A voice powerful, yet singing with a carefull touch, like she http://yourdailyintake.blogspot.com/2008/08/its-like-there-is-factory-somewhere.htmlnoreply@blogger.com (Liliane)0tag:blogger.com,1999:blog-2665522891664997409.post-4807431173927163189Sat, 23 Aug 2008 13:02:00 +00002008-08-23T19:02:34.761+02:00jokeusabilitygolden oldie, but a golden oldie worthy of my blog.http://yourdailyintake.blogspot.com/2008/08/how-projects-work.htmlnoreply@blogger.com (Liliane)1tag:blogger.com,1999:blog-2665522891664997409.post-6026577723510168704Fri, 22 Aug 2008 11:00:00 +00002008-08-23T13:54:51.391+02:00quoteI would love to change the world, but they won't give me the source codehttp://yourdailyintake.blogspot.com/2008/08/change-world.htmlnoreply@blogger.com (Liliane)2tag:blogger.com,1999:blog-2665522891664997409.post-3175414142873141697Tue, 12 Aug 2008 13:47:00 +00002008-08-23T13:56:20.220+02:00free musiclowlandsmusicAlready packed your stuff for Lowlands 2008?? Getting ready for a trip to Biddinghuizen? Tune in to the Lowlands Free Sampler 2008! Listen to it in on your mp3-player, in your car, in the train, or even when you haven't got your hands on a ticket for lowlands (bummer).Get it here: www.iTunes.com/nl/lowlandsfestivalYeah sorry, iTunes is mandatory.Get loooooosssss with N.E.R.D., Crystal Castles, http://yourdailyintake.blogspot.com/2008/08/lowlands-tracks-we-lovv-you.htmlnoreply@blogger.com (Liliane)2tag:blogger.com,1999:blog-2665522891664997409.post-8196930156313179999Thu, 24 Jul 2008 19:12:00 +00002008-07-24T22:14:40.399+02:00boysfashionstreetwearSomething for the boys!I was visiting Haarlem the other day and came across a sticker with newdimension-clothing.com written on it. Curious as I am, I checked the website.The fall/winter collection embodies a graphic new-rave electro feeling. It exists of t-shirts, sweats, boxers and jeans. The sweats remind me of one of my favourite brands at the moment: OnTour (check this one out, also women http://yourdailyintake.blogspot.com/2008/07/for-boys-new-dimension-clothing.htmlnoreply@blogger.com (Liliane)5tag:blogger.com,1999:blog-2665522891664997409.post-5218003890147394455Wed, 04 Jun 2008 16:27:00 +00002008-06-04T18:43:32.416+02:00blogcatzRSS-feed is working again, so update your newsfeed! (click the RSS-icon in the upper right corner)and to make this post not too pointless:catz rule teh world!1)0)!)!11101010~http://yourdailyintake.blogspot.com/2008/06/rss-feed-working-again.htmlnoreply@blogger.com (Liliane)3tag:blogger.com,1999:blog-2665522891664997409.post-1101934885116557832Mon, 19 May 2008 07:00:00 +00002008-05-19T09:00:01.824+02:00gadgetsheadphonesWant great sound but looking 'fashionable' too?We all know the Skullcandy headphones that are taking over your local shops, streets, the world... if fake fur is not your thing but you still want to make a fashion statement, try the headphones of Boosted. You probably have heard about BoostedMobile, they now came up with a series of headphones. My personal favourite is The Grande Headphones in http://yourdailyintake.blogspot.com/2008/05/musthave-monday-boosted-grande.htmlnoreply@blogger.com (Liliane)2tag:blogger.com,1999:blog-2665522891664997409.post-4802507164344600635Sun, 18 May 2008 06:35:00 +00002008-05-18T14:31:30.763+02:00bebel gilbertobossa novabrazilmusicBebel Gilberto, not only beautiful but also capable of making some really good music.With a Brazilian background, a father who is called the father of Bossa Nova, a mother who was a singer and her uncle Chico Buarque (singer/songwriter) she evidently grew up with music. At the early age of seven she already gained some musical experience by singing on her mothers first solo album. By age nine shehttp://yourdailyintake.blogspot.com/2008/05/bebel-gilberto.htmlnoreply@blogger.com (Liliane)0tag:blogger.com,1999:blog-2665522891664997409.post-7195506367768502328Sat, 17 May 2008 10:18:00 +00002008-05-17T12:32:54.609+02:00blogOn Sunday, the 17th of May, I will switch to http://yourdailyintake.blogspot.com .Update your bookmarks!http://yourdailyintake.blogspot.com/2008/05/update-your-bookmarks.htmlnoreply@blogger.com (Liliane)1tag:blogger.com,1999:blog-2665522891664997409.post-6235767973972813621Wed, 14 May 2008 10:09:00 +00002008-05-17T12:30:58.099+02:00homeFrustrated with those electric wires across your room?? I know I do!Pretty nice idea, thought of something likewise myself. Only problem is that my wires are hiding in places you still wouldn't see the prettyness, even if I patched things up. Oh well..Do your wires need a make-over? Maybe this will give you some ideas Flower hooks for wirehttp://yourdailyintake.blogspot.com/2008/05/blog-post.htmlnoreply@blogger.com (Liliane)1tag:blogger.com,1999:blog-2665522891664997409.post-8941374827995400767Tue, 06 May 2008 13:13:00 +00002008-05-17T12:17:27.662+02:00gamesGemaakt door Denis Stepkin, gaaf concept. Check it out!Polcarstvahttp://yourdailyintake.blogspot.com/2008/05/polcarstva.htmlnoreply@blogger.com (Liliane)2tag:blogger.com,1999:blog-2665522891664997409.post-6122688803199325702Thu, 01 May 2008 18:31:00 +00002008-05-01T20:44:31.865+02:00poemIk ben zo bang dat je strakjes verdwijnt,vervaagt in mist en dan nooit meer verschijnt,oplost in zonlicht of smelt in de regen,ja, dat komt voor en wat doe je ertegen?wegvliegt door 't raam als een heel domme vlinder,hoge beloning voor Eerlijke Vinder.Ik zou je het liefste in een doosje willen doenen je bewaren, heel goed bewaren.Dan zou ik je verzekeren voor anderhalf miljoenen telkens zou ik http://yourdailyintake.blogspot.com/2008/05/doosje.htmlnoreply@blogger.com (Liliane)2